| Clone Name | rbastl27a02 |
|---|---|
| Clone Library Name | barley_pub |
>YMF11_MARPO (P38456) Hypothetical 83.1 kDa protein in COB-ATPA intergenic| region (ORF 732) Length = 732 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 90 YFVHCPHTYRKGKNAHSTLPQLNDT---TIW 173 YF+ C H +R G++ H+ L Q+ T+W Sbjct: 262 YFLSCSHGFRPGRSQHTCLKQIRRDFVGTVW 292
>METK_SULTO (Q976F3) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 405 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +1 Query: 160 IQQYGDLIHFTAQKAVVLTSKALARLQGGTPPNNLYLQTIPRA 288 +++YG ++H K +V+ +A R +GG +Y+ RA Sbjct: 50 LKRYGTILHHNLDKTLVVGGQASPRFKGGEVLQPIYIIVAGRA 92
>UTX_HUMAN (O15550) Ubiquitously transcribed X chromosome tetratricopeptide| repeat protein (Ubiquitously transcribed TPR protein on the X chromosome) Length = 1401 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 228 CSPPRGNSPK*SLFTNDSPRLSLLL 302 CSP G+S L ++D+P+LS LL Sbjct: 760 CSPSHGDSKSPGLLSSDNPQLSALL 784
>UTX_MOUSE (O70546) Ubiquitously transcribed X chromosome tetratricopeptide| repeat protein (Ubiquitously transcribed TPR protein on the X chromosome) (Fragment) Length = 1333 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 228 CSPPRGNSPK*SLFTNDSPRLSLLL 302 CSP G+S L ++D+P+LS LL Sbjct: 692 CSPSHGDSKSPGLLSSDNPQLSALL 716
>METK_SULSO (Q980S9) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 404 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +1 Query: 160 IQQYGDLIHFTAQKAVVLTSKALARLQGGTPPNNLYLQTIPRA 288 +++YG ++H K +V+ +A R +GG +Y+ RA Sbjct: 50 LKKYGVILHHNLDKTLVVGGQATPRFKGGDIIQPIYIIVAGRA 92
>METK_PYRFU (Q8TZW1) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 401 Score = 27.3 bits (59), Expect = 8.8 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +1 Query: 142 LCRN*MIQQYGDLIHFTAQKAVVLTSKALARLQGGTPPNNLYLQTIPRA 288 LCR I++YG ++H + V+ +A R GG +Y+ RA Sbjct: 46 LCRE-YIRRYGVILHHNTDQVEVVGGRAYPRFGGGEVVKPIYILLSGRA 93
>PTN22_MOUSE (P29352) Tyrosine-protein phosphatase non-receptor type 22 (EC| 3.1.3.48) (Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP) Length = 802 Score = 27.3 bits (59), Expect = 8.8 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = +1 Query: 136 TPLCRN*MIQQYGDLIHFTAQKAVVLTSKALARLQGGTPPNNLYLQTIPRAFLS 297 +P C + D + FT K V L S R Q G+PP L +T+ FL+ Sbjct: 650 SPECSGTSEMKSHDSVGFTPSKNVKLRSPKSDRHQDGSPPPPLPERTLESFFLA 703 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,298,913 Number of Sequences: 219361 Number of extensions: 1239592 Number of successful extensions: 2264 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2261 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)