| Clone Name | rbastl26g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EGR2_RAT (P51774) Early growth response protein 2 (EGR-2) (Krox-... | 31 | 1.0 | 2 | EGR2_MOUSE (P08152) Early growth response protein 2 (EGR-2) (Kro... | 31 | 1.0 | 3 | EGR2_HUMAN (P11161) Early growth response protein 2 (EGR-2) (Kro... | 29 | 5.2 | 4 | CSF2R_MOUSE (Q00941) Granulocyte-macrophage colony-stimulating f... | 28 | 6.7 |
|---|
>EGR2_RAT (P51774) Early growth response protein 2 (EGR-2) (Krox-20 protein)| Length = 470 Score = 31.2 bits (69), Expect = 1.0 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 Query: 331 RQDKHIGAGPDRAAGSCPSDSLHLP 257 ++D H AGPDR CP DSL +P Sbjct: 235 QRDPHGAAGPDRKPFPCPLDSLRVP 259
>EGR2_MOUSE (P08152) Early growth response protein 2 (EGR-2) (Krox-20 protein)| Length = 470 Score = 31.2 bits (69), Expect = 1.0 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 Query: 331 RQDKHIGAGPDRAAGSCPSDSLHLP 257 ++D H AGPDR CP DSL +P Sbjct: 235 QRDPHGAAGPDRKPFPCPLDSLRVP 259
>EGR2_HUMAN (P11161) Early growth response protein 2 (EGR-2) (Krox-20 protein)| (AT591) Length = 476 Score = 28.9 bits (63), Expect = 5.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 331 RQDKHIGAGPDRAAGSCPSDSLHLP 257 ++D H AGPDR CP D+L +P Sbjct: 235 QRDLHGTAGPDRKPFPCPLDTLRVP 259
>CSF2R_MOUSE (Q00941) Granulocyte-macrophage colony-stimulating factor receptor| alpha chain precursor (GM-CSF-R-alpha) (GMR) (CD116 antigen) Length = 388 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +1 Query: 214 AKLISKRWFTGPEAPVDGGYHWDKTQQRDLDLLRCACPDGD 336 A+ +S W GP AP D Y D+ RC GD Sbjct: 140 ARFLSCAWREGPAAPADVRYSLRVLNSTGHDVARCMADPGD 180 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,653,333 Number of Sequences: 219361 Number of extensions: 1381311 Number of successful extensions: 3267 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3263 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)