| Clone Name | rbastl26f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AKL1_YEAST (P38080) Serine/threonine-protein kinase AKL1 (EC 2.7... | 29 | 4.9 | 2 | CI061_HUMAN (Q15884) Protein C9orf61 (Protein X123) | 29 | 6.4 |
|---|
>AKL1_YEAST (P38080) Serine/threonine-protein kinase AKL1 (EC 2.7.11.1)| Length = 1108 Score = 29.3 bits (64), Expect = 4.9 Identities = 19/79 (24%), Positives = 34/79 (43%) Frame = +2 Query: 50 CFQIPTRAEAGLLRLGNSNTLHTYTPTFQTACHAYREGKPEFPADKKVQVMLHRVAFLLG 229 C I +++ L + L TP T A K EFP +K +++ + +L Sbjct: 242 CLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIMLA 301 Query: 230 TVPNMNKIPQLLKCIHGLC 286 PN+ P + + ++ LC Sbjct: 302 ENPNLR--PNIYQVLYHLC 318
>CI061_HUMAN (Q15884) Protein C9orf61 (Protein X123)| Length = 289 Score = 28.9 bits (63), Expect = 6.4 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 56 QIPTRAEAGLLRLGNSNTLHTYTP 127 ++P+R + GLL L + LHT+TP Sbjct: 236 KLPSRRQPGLLHLQSCGDLHTFTP 259 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,044,274 Number of Sequences: 219361 Number of extensions: 1358855 Number of successful extensions: 3158 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3157 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)