| Clone Name | rbastl26c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HGT1_CANAL (O74713) High-affinity glucose transporter | 29 | 3.3 | 2 | VD05_VARV (P33069) Protein D5 | 28 | 7.4 | 3 | TYCC_BREPA (O30409) Tyrocidine synthetase 3 (Tyrocidine syntheta... | 28 | 7.4 |
|---|
>HGT1_CANAL (O74713) High-affinity glucose transporter| Length = 545 Score = 28.9 bits (63), Expect = 3.3 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +2 Query: 233 GCGH--EVAKRRLKWGMTRSPGACLFL 307 G GH VA R+ WG+ PG CLFL Sbjct: 180 GLGHINGVASFRIAWGLQIVPGLCLFL 206
>VD05_VARV (P33069) Protein D5| Length = 785 Score = 27.7 bits (60), Expect = 7.4 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = +2 Query: 44 NLEENNNKIASCAKLDYYYYCSTLEQLYS*VQ*T*HLHPHQYLVEDDAV*SVSRISYDHS 223 +L+ENN +DY C+ ++ H HPHQ +E+DA+ + + HS Sbjct: 263 DLDENNFTTVPLV-IDYVTPCALCKKRS-------HKHPHQLSLENDAI-RIYKTGNPHS 313 Query: 224 C 226 C Sbjct: 314 C 314
>TYCC_BREPA (O30409) Tyrocidine synthetase 3 (Tyrocidine synthetase III)| [Includes: ATP-dependent asparagine adenylase (AsnA) (Asparagine activase); ATP-dependent glutamine adenylase (GlnA) (Glutamine activase); ATP-dependent tyrosine adenylase (TyrA) (Ty Length = 6486 Score = 27.7 bits (60), Expect = 7.4 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 7/67 (10%) Frame = -1 Query: 305 ETGMPLVTSSCPIL---TAFLPLHGHTPE----YKSDHMKCVKHFTQRHLRPNTDADGGV 147 E + L+ + +L A+LP+ P+ Y D + TQ HL+PN G V Sbjct: 522 EHSLELIVAIMAVLRSGAAYLPIDPEYPQDRIQYLLDDSQTTLLLTQSHLQPNIRFAGSV 581 Query: 146 MFIALRS 126 +++ RS Sbjct: 582 LYLDDRS 588 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,390,546 Number of Sequences: 219361 Number of extensions: 870299 Number of successful extensions: 1767 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1767 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)