| Clone Name | rbastl26c04 |
|---|---|
| Clone Library Name | barley_pub |
>GAT5B_XENLA (P43696) GATA-binding factor 5-B (Transcription factor xGATA-5B)| Length = 388 Score = 31.2 bits (69), Expect = 1.0 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -1 Query: 385 ESHMEKTKAPMTPNVLSLGKKPPVGEGAAGKGG 287 ESH +P TP+ S PPVG +A GG Sbjct: 73 ESHAFNASSPHTPSGFSYSHSPPVGNSSARDGG 105
>GAT5A_XENLA (P43695) GATA-binding factor 5-A (Transcription factor xGATA-5A)| Length = 390 Score = 30.8 bits (68), Expect = 1.4 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -1 Query: 385 ESHMEKTKAPMTPNVLSLGKKPPVGEGAAGKGG 287 ESH +P TP S PPVG +A GG Sbjct: 72 ESHAFNASSPHTPTGFSYSHSPPVGNSSARDGG 104
>FHAB_BORPE (P12255) Filamentous hemagglutinin| Length = 3590 Score = 30.8 bits (68), Expect = 1.4 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 45 ITAAMAVQYFQDYLQFSLTANTN*CSHSKGDWKNRNTVERMHHLLD 182 + A++YF+ L SLTA N S W ++T E + +LLD Sbjct: 1907 VRTVSAMEYFKTPLPVSLTALDNRAGLSPATWNFQSTYELLDYLLD 1952
>REPS1_MOUSE (O54916) RalBP1-associated Eps domain-containing protein 1| (RalBP1-interacting protein 1) Length = 743 Score = 28.9 bits (63), Expect = 5.1 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = -2 Query: 312 VKEQPAKAGQGGGPTSRVKTKTRQELAGTWRATLPLLPEGDQDYPEDDASSQLYSGFSSL 133 V EQP + G G P +K+ P +P +Q +PE + SS+ + FS Sbjct: 328 VGEQPGEVGYSGSPAEAPPSKS------------PSMPSLNQTWPELNQSSEQWETFSER 375 Query: 132 PSN 124 S+ Sbjct: 376 SSS 378
>FOG_DROME (P40795) Protein folded gastrulation precursor [Contains: Protein| folded gastrulation; G protein-coupled receptor ligand] Length = 730 Score = 28.5 bits (62), Expect = 6.7 Identities = 22/64 (34%), Positives = 31/64 (48%) Frame = -2 Query: 273 PTSRVKTKTRQELAGTWRATLPLLPEGDQDYPEDDASSQLYSGFSSLPSNVNINLCWP*V 94 PT VK + LAG + P P GD DY +D+ S ++ S +P+ + L P V Sbjct: 90 PTDLVKQELI--LAGGSNGSPPPPPIGDYDYGDDEESEEIVYDLSVIPTAMQDGLP-PSV 146 Query: 93 RIGD 82 GD Sbjct: 147 GTGD 150
>AKA12_HUMAN (Q02952) A-kinase anchor protein 12 (A-kinase anchor protein 250| kDa) (AKAP 250) (Myasthenia gravis autoantigen gravin) Length = 1781 Score = 28.5 bits (62), Expect = 6.7 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = -1 Query: 424 GQTKVSDSAGFRRESHMEKTKAPMTPNVLSLGKKPPVGEGAAGKG 290 G KV GF+ +KT+ P T +L++ K GEGAAG G Sbjct: 170 GFKKVFKFVGFKFTVKKDKTEKPDTVQLLTV--KKDEGEGAAGAG 212
>K1043_HUMAN (Q96AY4) TPR repeat-containing protein KIAA1043| Length = 1716 Score = 28.5 bits (62), Expect = 6.7 Identities = 18/55 (32%), Positives = 25/55 (45%) Frame = -2 Query: 303 QPAKAGQGGGPTSRVKTKTRQELAGTWRATLPLLPEGDQDYPEDDASSQLYSGFS 139 +P +GGGP R + R + A R+TLP Q P + + Y GFS Sbjct: 1242 KPEGGSEGGGPGGR-QDHDRSKNAYLQRSTLPRSQLPPQTRPAGNKDEEEYEGFS 1295
>POL2_RRVS (P36324) RNA2 polyprotein (P2) [Contains: P2A protein (2A);| Movement protein (2B-MP); Coat protein (2C-CP)] Length = 1107 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 50 CGHGGAIFPRLSPILTHGQHKLMFTFE 130 C +FP LS + H QH L+ +FE Sbjct: 30 CALSSPLFPELSKLDAHSQHHLLASFE 56
>5S_PROFR (Q70AC7) Methylmalonyl-CoA carboxyltransferase 5S subunit (EC| 2.1.3.1) (Transcarboxylase 5S subunit) Length = 505 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 67 NISKIISNSHSRPTQINVHIRRETGKTGIQLRGCI 171 +I K I +++ + TQIN+H TG T + L I Sbjct: 197 DIIKAIKDTYGQKTQINLHCHSTTGVTEVSLMKAI 231 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,086,298 Number of Sequences: 219361 Number of extensions: 1095866 Number of successful extensions: 3378 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3377 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)