| Clone Name | rbastl25f02 |
|---|---|
| Clone Library Name | barley_pub |
>CMTA5_ARATH (O23463) Calmodulin-binding transcription activator 5| (Signal-responsive protein 6) (Ethylene-induced calmodulin-binding protein f) (EICBP.f) Length = 923 Score = 62.8 bits (151), Expect = 4e-10 Identities = 28/48 (58%), Positives = 40/48 (83%) Frame = -3 Query: 444 SRQQAEDRFNRSVVRVQALFRCHRAQHEYRRMRIAHEEAKLEFSKEQQ 301 S++QAE+R RSVV+VQA+FR +AQ +YRRM++AHEEA+LE+ Q+ Sbjct: 867 SQKQAEERLERSVVKVQAMFRSKKAQQDYRRMKLAHEEAQLEYDGMQE 914
>CMTA6_ARATH (Q9LSP8) Calmodulin-binding transcription activator 6| (Signal-responsive protein 3) (Ethylene-induced calmodulin-binding protein e) (EICBP.e) (Ethylene-induced calmodulin-binding protein 5) (EICBP5) Length = 838 Score = 57.0 bits (136), Expect = 2e-08 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = -3 Query: 444 SRQQAEDRFNRSVVRVQALFRCHRAQHEYRRMRIAHEEAKL 322 S++QAE+R RSVVRVQA+FR +AQ +YRRM++ HEEA++ Sbjct: 780 SQRQAEERLERSVVRVQAMFRSKKAQQDYRRMKLTHEEAQV 820
>CMTA3_ARATH (Q8GSA7) Calmodulin-binding transcription activator 3| (Signal-responsive protein 1) (Ethylene-induced calmodulin-binding protein a) (EICBP.a) (Ethylene-induced calmodulin-binding protein 1) (EICBP1) Length = 1032 Score = 31.6 bits (70), Expect = 0.95 Identities = 16/52 (30%), Positives = 34/52 (65%), Gaps = 3/52 (5%) Frame = -3 Query: 441 RQQAEDRFNRSVVRVQALFRCHRAQHEYRR-MRIAH--EEAKLEFSKEQQQA 295 R+Q EDR +++ RV+++ + A+ +YRR + + + +E+K+E + E +A Sbjct: 948 RKQTEDRLQKALARVKSMVQYPEARDQYRRLLNVVNDIQESKVEKALENSEA 999
>CCD41_MOUSE (Q9D5R3) Coiled-coil domain-containing protein 41| Length = 692 Score = 28.5 bits (62), Expect = 8.1 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = -3 Query: 444 SRQQAEDRFNRSVVRVQALFRCHRAQHEYRRMRIAHEEAKLEFSKEQQQ 298 SR E F ++ + RC +H Y+ ++I H+ + E+ K Q + Sbjct: 14 SRLNPEPEFQNMLIDERV--RCEHHKHNYQALKIEHKRLQEEYVKSQNE 60
>M4K4_HUMAN (O95819) Mitogen-activated protein kinase kinase kinase kinase 4| (EC 2.7.11.1) (MAPK/ERK kinase kinase kinase 4) (MEK kinase kinase 4) (MEKKK 4) (HPK/GCK-like kinase HGK) (Nck-interacting kinase) Length = 1239 Score = 28.5 bits (62), Expect = 8.1 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -3 Query: 441 RQQAEDRFNRSVVRVQALFRCH--RAQHEYRRMRIAHEEAKLEFSKEQQQ 298 R Q E++ +R Q L + R Q EY+R +A + ++E KEQ++ Sbjct: 358 RLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRR 407
>M4K4_MOUSE (P97820) Mitogen-activated protein kinase kinase kinase kinase 4| (EC 2.7.11.1) (MAPK/ERK kinase kinase kinase 4) (MEK kinase kinase 4) (MEKKK 4) (HPK/GCK-like kinase HGK) (Nck-interacting kinase) Length = 1233 Score = 28.5 bits (62), Expect = 8.1 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -3 Query: 441 RQQAEDRFNRSVVRVQALFRCH--RAQHEYRRMRIAHEEAKLEFSKEQQQ 298 R Q E++ +R Q L + R Q EY+R +A + ++E KEQ++ Sbjct: 357 RLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRR 406 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,190,506 Number of Sequences: 219361 Number of extensions: 994140 Number of successful extensions: 2070 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2070 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)