| Clone Name | rbastl25e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | WRK19_ARATH (Q9SZ67) Probable WRKY transcription factor 19 (WRKY... | 30 | 3.3 | 2 | GLGB_PHOPR (Q6LHN1) 1,4-alpha-glucan branching enzyme (EC 2.4.1.... | 29 | 4.3 | 3 | ATL3H_ARATH (Q9LJL6) Putative RING-H2 finger protein ATL3H | 28 | 9.7 |
|---|
>WRK19_ARATH (Q9SZ67) Probable WRKY transcription factor 19 (WRKY DNA-binding| protein 19) Length = 1895 Score = 29.6 bits (65), Expect = 3.3 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Frame = +1 Query: 10 LSSKSHLALIFLCLYKKKHLQKQNQPACL-----PA*SVK*KCCQTLDLER 147 L + HL + +YK KHL+ N C+ P S + KC + LDL R Sbjct: 1379 LENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSR 1429
>GLGB_PHOPR (Q6LHN1) 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) (Glycogen| branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length = 716 Score = 29.3 bits (64), Expect = 4.3 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +2 Query: 92 AYLHDL*NENVAKLLISSATFLPHLYNIQGLKLNPV 199 +Y++D ++V + LIS+A F Y+I GL+++ V Sbjct: 361 SYIYDYGRDHVRRFLISNALFWLEHYHIDGLRVDAV 396
>ATL3H_ARATH (Q9LJL6) Putative RING-H2 finger protein ATL3H| Length = 141 Score = 28.1 bits (61), Expect = 9.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 99 CMICKMKMLPNS*SRALPSCHTCTTF 176 C++C K + +R LPSC+ C F Sbjct: 79 CVVCLSKFIDEDKARVLPSCNHCFHF 104 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,039,375 Number of Sequences: 219361 Number of extensions: 915175 Number of successful extensions: 1574 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1574 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)