| Clone Name | rbastl25c12 |
|---|---|
| Clone Library Name | barley_pub |
>RTN4R_MACFA (Q9N0E3) Reticulon-4 receptor precursor (Nogo receptor) (NgR)| (Nogo-66 receptor) Length = 473 Score = 29.6 bits (65), Expect = 2.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 32 RIRATWGWISVDRGSKATLPLTMPRRV 112 R R W W+ RGS + +P ++P+R+ Sbjct: 267 RARPLWAWLQKFRGSSSEVPCSLPQRL 293
>RTN4R_HUMAN (Q9BZR6) Reticulon-4 receptor precursor (Nogo receptor) (NgR)| (Nogo-66 receptor) Length = 473 Score = 29.6 bits (65), Expect = 2.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 32 RIRATWGWISVDRGSKATLPLTMPRRV 112 R R W W+ RGS + +P ++P+R+ Sbjct: 267 RARPLWAWLQKFRGSSSEVPCSLPQRL 293
>RTN4R_RAT (Q99M75) Reticulon-4 receptor precursor (Nogo receptor) (NgR)| (Nogo-66 receptor) Length = 473 Score = 29.3 bits (64), Expect = 3.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +2 Query: 32 RIRATWGWISVDRGSKATLPLTMPRRV 112 R R W W+ RGS + +P +P+R+ Sbjct: 267 RARPLWAWLQKFRGSSSEVPCNLPQRL 293
>RTN4R_MOUSE (Q99PI8) Reticulon-4 receptor precursor (Nogo receptor) (NgR)| (Nogo-66 receptor) Length = 473 Score = 29.3 bits (64), Expect = 3.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +2 Query: 32 RIRATWGWISVDRGSKATLPLTMPRRV 112 R R W W+ RGS + +P +P+R+ Sbjct: 267 RARPLWAWLQKFRGSSSEVPCNLPQRL 293
>PANB_WIGBR (Q8D2A5) 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC| 2.1.2.11) (Ketopantoate hydroxymethyltransferase) Length = 265 Score = 28.5 bits (62), Expect = 5.3 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -2 Query: 156 LPNGRWAESFADDLNTRRGIVSGRVALLPRSTEIQ 52 L G W +LNTR V G + L P+S +Q Sbjct: 113 LEGGLWVSDIIHELNTRSIPVCGHIGLTPQSINMQ 147 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,134,360 Number of Sequences: 219361 Number of extensions: 517098 Number of successful extensions: 1322 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1322 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)