| Clone Name | rbastl25b11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUOB_AQUAE (O67334) NADH-quinone oxidoreductase chain B (EC 1.6.... | 32 | 0.45 | 2 | RA51B_MOUSE (O35719) DNA repair protein RAD51 homolog 2 (R51H2) ... | 30 | 2.3 | 3 | GABD_DEIRA (O32507) Succinate-semialdehyde dehydrogenase [NADP+]... | 28 | 8.6 |
|---|
>NUOB_AQUAE (O67334) NADH-quinone oxidoreductase chain B (EC 1.6.99.5) (NADH| dehydrogenase I, chain B) (NDH-1, chain B) Length = 179 Score = 32.3 bits (72), Expect = 0.45 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = -3 Query: 393 ASPKEAEGPPLLVKLRTDVNRVTPMVETVLEKL--PRWCAPFGKSTS 259 ASP++A+ +L+ T VN+V PM++ + +++ P+WC G S Sbjct: 59 ASPRQAD---VLIVAGTVVNKVAPMLKLIWDQMPDPKWCISMGGCAS 102
>RA51B_MOUSE (O35719) DNA repair protein RAD51 homolog 2 (R51H2) (RAD51-like| protein 1) Length = 350 Score = 30.0 bits (66), Expect = 2.3 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -2 Query: 295 STLVCALRQVDISLHAGVPDRSSSQYLGDPHCVPQHFSLL 176 ST +CAL D +LH GVP S ++ G P C F ++ Sbjct: 84 STTLCAL---DEALHGGVPCGSLTEITGPPGCGKTQFCIM 120
>GABD_DEIRA (O32507) Succinate-semialdehyde dehydrogenase [NADP+] (EC 1.2.1.16)| (SSDH) Length = 477 Score = 28.1 bits (61), Expect = 8.6 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +2 Query: 191 LGNAMRVA*IL-TGRAVRNASV*GDVDLPKGAHQRGSFSRTVSTIGVTLFTS 343 L A RVA L TG N DLP G +R F R +S++G+ FT+ Sbjct: 408 LDRAQRVAERLDTGMVWINHPTSSAADLPFGGVKRSGFGRELSSMGMLEFTN 459 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,557,467 Number of Sequences: 219361 Number of extensions: 1048837 Number of successful extensions: 2439 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2437 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)