| Clone Name | rbastl25a12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLMS_TREPA (O83833) Glucosamine--fructose-6-phosphate aminotrans... | 31 | 1.00 | 2 | PHSA_SALTY (P37600) Thiosulfate reductase precursor (EC 1.-.-.-) | 28 | 5.0 |
|---|
>GLMS_TREPA (O83833) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 634 Score = 30.8 bits (68), Expect = 1.00 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -1 Query: 159 CN*LQSCLVARMDRHATCTHSGGHVGVELVVSFDLKLICICI 34 CN +S LV D TH+G +GV SF +L+C+ + Sbjct: 387 CNGARSTLVRESDA-VLLTHAGSEIGVASTKSFTTQLVCLLV 427
>PHSA_SALTY (P37600) Thiosulfate reductase precursor (EC 1.-.-.-)| Length = 758 Score = 28.5 bits (62), Expect = 5.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 2 SSKDVTFSTHLIHIQISLRSKDTTSSTPTCP 94 SSK + S+HL H+ + S +T + TCP Sbjct: 145 SSKSGSLSSHLFHLATAFGSPNTFTHASTCP 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,355,208 Number of Sequences: 219361 Number of extensions: 701553 Number of successful extensions: 2134 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2134 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)