| Clone Name | rbastl24e04 |
|---|---|
| Clone Library Name | barley_pub |
>Q300_MOUSE (Q02722) Protein Q300| Length = 77 Score = 30.0 bits (66), Expect = 1.7 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -1 Query: 63 CMCVCISVCVCTV 25 C+CVC+ VCVCT+ Sbjct: 30 CVCVCVCVCVCTL 42 Score = 27.7 bits (60), Expect = 8.7 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -1 Query: 63 CMCVCISVCVC 31 C+CVC+ VCVC Sbjct: 28 CVCVCVCVCVC 38
>LTB1S_MOUSE (Q8CG18) Latent transforming growth factor beta-binding protein,| isoform 1S precursor (LTBP-1) (Transforming growth factor beta-1-binding protein 1) (TGF-beta1-BP-1) Length = 1389 Score = 29.3 bits (64), Expect = 3.0 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 4/57 (7%) Frame = +3 Query: 30 YRHKRLYIHTYTHPISKMLVTCFRENTLLQLFWPLPGL----*LCRRFITSRGFGNC 188 Y H++L H Y L CF+E Q LPGL C TS GF C Sbjct: 207 YSHQQLIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKC 263
>PHXR4_MOUSE (P15974) Putative per-hexamer repeat protein 4| Length = 95 Score = 29.3 bits (64), Expect = 3.0 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -1 Query: 69 GECMCVCISVCVC 31 G C+CVC SVC+C Sbjct: 8 GVCLCVCFSVCMC 20
>LTB1L_HUMAN (Q14766) Latent transforming growth factor beta-binding protein,| isoform 1L precursor (LTBP-1) (Transforming growth factor beta-1-binding protein 1) (TGF-beta1-BP-1) Length = 1595 Score = 28.1 bits (61), Expect = 6.6 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 4/57 (7%) Frame = +3 Query: 30 YRHKRLYIHTYTHPISKMLVTCFRENTLLQLFWPLPGL----*LCRRFITSRGFGNC 188 Y H+++ H Y L CF+E Q LPGL C TS GF C Sbjct: 413 YSHQQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKC 469
>LTBP1_RAT (Q00918) Latent transforming growth factor beta-binding protein 1| precursor (LTBP-1) (Transforming growth factor beta-1-binding protein 1) (TGF-beta-1-BP-1) (Transforming growth factor beta-1-masking protein, large subunit) Length = 1712 Score = 28.1 bits (61), Expect = 6.6 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 4/57 (7%) Frame = +3 Query: 30 YRHKRLYIHTYTHPISKMLVTCFRENTLLQLFWPLPGL----*LCRRFITSRGFGNC 188 Y H+++ H Y L CF+E Q LPGL C TS GF C Sbjct: 530 YSHQQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKC 586
>LTB1S_HUMAN (P22064) Latent transforming growth factor beta-binding protein,| isoform 1S precursor (LTBP-1) (Transforming growth factor beta-1-binding protein 1) (TGF-beta1-BP-1) Length = 1394 Score = 28.1 bits (61), Expect = 6.6 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 4/57 (7%) Frame = +3 Query: 30 YRHKRLYIHTYTHPISKMLVTCFRENTLLQLFWPLPGL----*LCRRFITSRGFGNC 188 Y H+++ H Y L CF+E Q LPGL C TS GF C Sbjct: 212 YSHQQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKC 268
>CEJ1_CAEEL (Q17802) Cytokinesis protein cej-1 precursor (Cell junction protein| 1) Length = 584 Score = 27.7 bits (60), Expect = 8.7 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = -2 Query: 191 VAVSKTTAGDEPTTQL---*TWQWPEQLK*SIFSETCYQHFRNRVS 63 + V TTA D PTT + T + P ++ + E C QH++N V+ Sbjct: 501 IVVESTTAADVPTTTVPAETTTEVPACVEGATAIEPCSQHYKNCVN 546
>CR015_HUMAN (Q96N68) Protein C18orf15| Length = 181 Score = 27.7 bits (60), Expect = 8.7 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 63 CMCVCISVCVC 31 CMCVC+ VC C Sbjct: 132 CMCVCVHVCAC 142 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,271,867 Number of Sequences: 219361 Number of extensions: 470234 Number of successful extensions: 1099 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1097 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)