| Clone Name | rbastl24d09 |
|---|---|
| Clone Library Name | barley_pub |
>UCRH_RAT (Q5M9I5) Ubiquinol-cytochrome c reductase complex 11 kDa protein,| mitochondrial precursor (EC 1.10.2.2) (Mitochondrial hinge protein) (Cytochrome C1, nonheme 11 kDa protein) (Complex III subunit VIII) Length = 89 Score = 30.0 bits (66), Expect = 1.6 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 21 DPKTEETEELATPKLKITTMPEVCQEKEK 107 DPK EE EEL P +TT+ E C++ EK Sbjct: 15 DPKEEEEEELVDP---LTTVREHCEQLEK 40
>UCRH_MOUSE (P99028) Ubiquinol-cytochrome c reductase complex 11 kDa protein,| mitochondrial precursor (EC 1.10.2.2) (Mitochondrial hinge protein) (Cytochrome C1, nonheme 11 kDa protein) (Complex III subunit VIII) Length = 89 Score = 30.0 bits (66), Expect = 1.6 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 21 DPKTEETEELATPKLKITTMPEVCQEKEK 107 DPK EE EEL P +TT+ E C++ EK Sbjct: 15 DPKEEEEEELVDP---LTTVREHCEQLEK 40
>DUS11_MOUSE (Q6NXK5) RNA/RNP complex-1-interacting phosphatase (EC 3.1.3.-)| (Phosphatase that interacts with RNA/RNP complex 1) (Dual-specificity protein phosphatase 11) Length = 321 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +3 Query: 24 PKTEETEELATPKLKITTMPEVCQEKEKQRRAGGNITPSTSLLGKTR 164 P+T+ E+ A P ++ T + ++K ++ R GG++ PS +T+ Sbjct: 212 PRTDGLEDSADPTEQVYTNNKPVKKKPRKNRRGGHLAPSQHFQHQTQ 258
>KRA49_HUMAN (Q9BYQ8) Keratin-associated protein 4-9 (Keratin-associated protein| 4.9) (Ultrahigh sulfur keratin-associated protein 4.9) (Fragment) Length = 191 Score = 29.3 bits (64), Expect = 2.7 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 214 ASACRSD---PSCTHPYCLNYSCAGTTLCH 294 +S CR P C P C SC TT CH Sbjct: 68 SSCCRPQCCQPVCCQPTCCRPSCCETTCCH 97
>PMA3_ARATH (P20431) ATPase 3, plasma membrane-type (EC 3.6.3.6) (Proton pump| 3) Length = 948 Score = 28.1 bits (61), Expect = 6.0 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +3 Query: 63 LKITTMPEVCQEKEKQRRAG--GNITPSTSLLGKTRD 167 +K+ T ++ KE RR G N+ PS+SLLGK +D Sbjct: 507 VKMITGDQLAIAKETGRRLGMGSNMYPSSSLLGKHKD 543
>CWC25_YARLI (Q6C1V6) Pre-mRNA-splicing factor CWC25| Length = 561 Score = 27.7 bits (60), Expect = 7.8 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 10/84 (11%) Frame = +1 Query: 19 LTQKQRKQRSLQRPN*RSQQCLRFA----KKKKNNGGPEGTSHHRLHYWAKQ------GI 168 +T+ R +R+ RP + + RFA K+K+ N P+G R A + G Sbjct: 405 VTRSHRDKRNSYRPEYKDEDDKRFAQRKDKEKEMNALPKGLQQMRAKLLASKKTTTVSGT 464 Query: 169 FSAHDDALTGSQLS*ASACRSDPS 240 A +GSQ + ++A S P+ Sbjct: 465 SQTPTSAPSGSQRTPSAASGSSPT 488
>PLCG1_RAT (P10686) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase| gamma 1 (EC 3.1.4.11) (Phosphoinositide phospholipase C) (PLC-gamma-1) (Phospholipase C-gamma-1) (PLC-II) (PLC-148) Length = 1290 Score = 27.7 bits (60), Expect = 7.8 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 118 PEGTSHHRLHYWAKQGIFSAHDDALTGSQLS*ASACRSDPSCTHPYC 258 PE ++ HYW I S+H+ LTG Q S S+ + C C Sbjct: 319 PETMNNPLSHYW----ISSSHNTYLTGDQFSSESSLEAYARCLRMGC 361
>HSP90_THEPA (P24724) Heat shock protein 90 (HSP90)| Length = 721 Score = 27.7 bits (60), Expect = 7.8 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +3 Query: 15 ELDPKTEETEELATPKLK-ITTMPEVCQEKEKQRRAGGNITPSTSLLGKTR 164 E PK ++ E++ K+ +T E +EK+K++R N+T +L K + Sbjct: 239 EEKPKDDKVEDVTDEKVTDVTDEEEKKEEKKKKKRKVTNVTREWEMLNKQK 289
>Y735_AGRT5 (Q8UHE7) Hypothetical RNA methyltransferase Atu0735/AGR_C_1331 (EC| 2.1.1.-) Length = 416 Score = 27.7 bits (60), Expect = 7.8 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 184 DALTGSQLS*ASACRSDPSCTH--PYCLNYSCAGTTLCH 294 D T ++ ASA R DP C H P +N +C G +L H Sbjct: 44 DQGTVMSITEASADRRDPVCRHFGPEGINGTCGGCSLQH 82 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,258,409 Number of Sequences: 219361 Number of extensions: 897204 Number of successful extensions: 2526 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2510 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)