| Clone Name | rbastl24d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LATA_LATMA (P23631) Alpha-latrotoxin precursor (Alpha-LTX) | 30 | 2.3 | 2 | PLTP_HUMAN (P55058) Phospholipid transfer protein precursor (Lip... | 28 | 6.5 |
|---|
>LATA_LATMA (P23631) Alpha-latrotoxin precursor (Alpha-LTX)| Length = 1401 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 43 KVNSGAVQLHYQNFKGKGKALHMLVKGD 126 K NSGA LH FKGK +A +L+ + Sbjct: 792 KTNSGATPLHLATFKGKSQAALILLNNE 819
>PLTP_HUMAN (P55058) Phospholipid transfer protein precursor (Lipid transfer| protein II) Length = 493 Score = 28.1 bits (61), Expect = 6.5 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Frame = +2 Query: 53 QELSNYTTKILRGKEKHF---IC*LKVTDCQFPSCRFRSK*QEKTII 184 QEL T LRGKE HF I +KVT+ Q S + Q++ ++ Sbjct: 44 QELETITIPDLRGKEGHFYYNISEVKVTELQLTSSELDFQPQQELML 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,599,793 Number of Sequences: 219361 Number of extensions: 413711 Number of successful extensions: 887 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 887 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)