| Clone Name | rbastl24c12 |
|---|---|
| Clone Library Name | barley_pub |
>ADRL_CAEEL (Q94177) ADIPOR-like receptor C43G2.1| Length = 434 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -3 Query: 154 CHSLLIIKIYLYFTQCPLLKICVLLFLVGYGIEPTYVGLYC 32 CHS+ ++KI+ C L + + L ++G I Y G YC Sbjct: 259 CHSVNVVKIF-----CKLDYMGISLLIIGSFIPWIYYGFYC 294
>L_SENDZ (P06447) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2228 Score = 28.1 bits (61), Expect = 6.7 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -3 Query: 151 HSLLIIKIYLYFTQCPLLKICVLLFLVGYGIEPTYVGLYC 32 H+LL K Y T L+ I L L GY + P V +YC Sbjct: 201 HNLLECKSYTLVTYGDLVMILNKLTLTGYILTPELVLMYC 240
>L_SENDF (Q06996) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2228 Score = 28.1 bits (61), Expect = 6.7 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -3 Query: 151 HSLLIIKIYLYFTQCPLLKICVLLFLVGYGIEPTYVGLYC 32 H+LL K Y T L+ I L L GY + P V +YC Sbjct: 201 HNLLECKSYTLVTYGDLVMILNKLTLTGYILTPELVLMYC 240
>L_SENDE (P06829) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2228 Score = 28.1 bits (61), Expect = 6.7 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -3 Query: 151 HSLLIIKIYLYFTQCPLLKICVLLFLVGYGIEPTYVGLYC 32 H+LL K Y T L+ I L L GY + P V +YC Sbjct: 201 HNLLECKSYTLVTYGDLVMILNKLTLTGYILTPELVLMYC 240
>L_SENDA (Q9DUD8) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2228 Score = 28.1 bits (61), Expect = 6.7 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -3 Query: 151 HSLLIIKIYLYFTQCPLLKICVLLFLVGYGIEPTYVGLYC 32 H+LL K Y T L+ I L L GY + P V +YC Sbjct: 201 HNLLECKSYTLVTYGDLVMILNKLTLTGYILTPELVLMYC 240
>CAPZB_SCHPO (Q9HGP5) Probable F-actin capping protein beta subunit| Length = 268 Score = 28.1 bits (61), Expect = 6.7 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 8 TKSTQPVSTVQPNISGLNAIAN 73 T+S QPVS QPN S L ++ N Sbjct: 243 TRSIQPVSDAQPNDSALRSVLN 264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,446,600 Number of Sequences: 219361 Number of extensions: 336479 Number of successful extensions: 699 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)