| Clone Name | rbastl24b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MRPD_BACSU (O05229) Na(+)/H(+) antiporter subunit D (Multiple re... | 32 | 0.65 |
|---|
>MRPD_BACSU (O05229) Na(+)/H(+) antiporter subunit D (Multiple resistance and| pH homeostasis protein D) (Mrp complex subunit D) Length = 493 Score = 32.0 bits (71), Expect = 0.65 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +3 Query: 150 NILFFLNAELCASNTILLTRHSFWENEEENPQTTFQHGKALVYP 281 ++L L++ L + + + H+FW E+E P+ + K L+YP Sbjct: 408 SMLILLSSLLVLYSVLRIFIHAFWGEEKETPKPNHRTAKGLLYP 451 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,893,119 Number of Sequences: 219361 Number of extensions: 1240074 Number of successful extensions: 3095 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3084 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)