| Clone Name | rbastl22f03 |
|---|---|
| Clone Library Name | barley_pub |
>UN13B_HUMAN (O14795) Unc-13 homolog B (Munc13-2) (munc13)| Length = 1591 Score = 30.8 bits (68), Expect = 0.84 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 49 GTEQLSRLQQPHAADPPRSQHNKVHTAHRSHT 144 G+ QLS L Q H D + + +H+ H SH+ Sbjct: 270 GSSQLSELDQYHEQDDDHRETDSIHSCHSSHS 301
>FOXJ3_MOUSE (Q8BUR3) Forkhead box protein J3| Length = 623 Score = 30.8 bits (68), Expect = 0.84 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 55 EQLSRLQQPHAADPPRSQHNKVHTAHRSHT 144 +Q S+LQ PH+ PP QH + H H+ T Sbjct: 406 QQHSQLQPPHSQHPPPHQHIQHHPNHQHQT 435
>NBR1_PONPY (Q5RC94) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) Length = 894 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -3 Query: 362 EMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 258 EMGF DR+ N +LL K+ +I + V +L+ D Sbjct: 854 EMGFCDRQLNLQLLKKHNYNILQVVTELLQLNNND 888
>UBIB_PSESM (Q87UZ0) Probable ubiquinone biosynthesis protein ubiB| Length = 539 Score = 29.6 bits (65), Expect = 1.9 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 Query: 61 LSRLQQPHAADPPRSQHNK 117 L R+ +PHA+DPPR H++ Sbjct: 468 LERMSRPHASDPPRPWHDR 486
>DSK2_SCHPO (Q10169) Deubiquitination-protection protein dph1| Length = 354 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = -3 Query: 365 SEMGFDDRETNKELLAKNGGSIKRAVMDLIA 273 +EMGF D E N + L ++GG+++ A+ L++ Sbjct: 322 NEMGFVDFERNVQALRRSGGNVQGAIESLLS 352
>SIN1_SCHPO (Q9P7Y9) Stress-activated map kinase-interacting protein 1| (SAPK-interacting protein 1) Length = 665 Score = 29.3 bits (64), Expect = 2.5 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 8/51 (15%) Frame = +1 Query: 64 SRLQQPHAADPPRSQH--------NKVHTAHRSHTNKSSQQFIGKLRDTLS 192 +++++ AA P +S+H NK H H S T+ SQ+ ++DTL+ Sbjct: 386 AQIKENQAAYPFKSKHPTSIPEANNKTHIRHTSSTSSQSQKQAQDVKDTLN 436
>HRP1_YEAST (Q99383) Nuclear polyadenylated RNA-binding protein 4 (Cleavage| factor IB) (CFIB) Length = 534 Score = 28.9 bits (63), Expect = 3.2 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 7/59 (11%) Frame = +1 Query: 55 EQLSRLQQPHAADPPRSQ--HNKVHTAHRSHTNKSSQQFIGKL-----RDTLSRYLGIY 210 + +S+ QQP + PP+ Q K + + +S + FIG L D L Y G Y Sbjct: 124 QTMSQFQQPSSQSPPQQQVTQTKEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKY 182
>Y3539_METJA (Q60294) Hypothetical UPF0252 protein MJECL39| Length = 351 Score = 28.9 bits (63), Expect = 3.2 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 14/88 (15%) Frame = -1 Query: 244 ELSNTYLSISIYICLNNE-TVCPVVCL*TAVKTCWCD--FCVR-------CELYYVVTVV 95 E SN Y I+ +I + + P V L WC+ FC+ C LY+++T++ Sbjct: 51 EKSNVYYFITFFIIVGLVWAIFPEVWL-------WCEQVFCISPTIHIIICCLYFIITII 103 Query: 94 GQLRVVAVIG----LVALFLLFNYCEWK 23 L + V+G L A F + C+ K Sbjct: 104 LFLFLCGVVGTFLHLWATFFTLSKCDSK 131
>NBR1_RAT (Q501R9) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) Length = 983 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 362 EMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 258 EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 943 EMGFCDRQLNLRLLRKHNHNILQVVTELLQVNNND 977
>NBR1_HUMAN (Q14596) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) (Membrane component, chromosome 17, surface marker 2) (1A1-3B) Length = 966 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 362 EMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 258 EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 926 EMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNND 960
>NBR1_MOUSE (P97432) Next to BRCA1 gene 1 protein (Neighbor of BRCA1 gene 1| protein) (Membrane component, chromosome 17, surface marker 2) Length = 988 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 362 EMGFDDRETNKELLAKNGGSIKRAVMDLIAREKKD 258 EMGF DR+ N LL K+ +I + V +L+ D Sbjct: 948 EMGFCDRQLNLRLLRKHNYNILQVVTELLQVNNND 982
>KNOX3_MAIZE (P56661) Homeobox protein knotted-1-like 3 (Fragment)| Length = 88 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 350 DDRETNKELLAKNGGSIKRAVMDLIAREKKDK 255 DD+E K+LL K G + +L + KKDK Sbjct: 1 DDKELKKQLLRKYSGCLGNLRKELCKKRKKDK 32
>PMEU1_LYCES (Q43143) Pectinesterase U1 precursor (EC 3.1.1.11) (Pectin| methylesterase) (PE) Length = 583 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -1 Query: 139 DFCVRCELYYVVTVVGQLRVVAVIGLVA 56 DFC R + Y+ V L V AVIG+VA Sbjct: 13 DFCKRKKKIYLAIVASVLLVAAVIGVVA 40
>SNF1_CANAL (P52497) Carbon catabolite derepressing protein kinase (EC| 2.7.11.1) Length = 620 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 61 LSRLQQPHA-ADPPRSQHNKVHTAHRSHTNKSSQQ 162 +S QP A AD + QHN H H H N++ Q Sbjct: 1 MSEQAQPQASADQQQHQHNHHHHHHHHHHNENQSQ 35
>FOXJ3_HUMAN (Q9UPW0) Forkhead box protein J3| Length = 622 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 55 EQLSRLQQPHAADPPRSQHNKVHTAHRSHT 144 +Q S+LQ PH P QH + H H+ T Sbjct: 405 QQHSQLQSPHPQHPSPHQHIQHHPNHQHQT 434
>POLG_HCVT5 (O92529) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3018 Score = 27.3 bits (59), Expect = 9.3 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = +1 Query: 19 RSSTHNS*IVGTEQLSRLQQPHAADPPRSQHNKVHTAHRSHTNKSSQQFIGKLRDTL 189 R+ST ++ ++ TE+ L PH+A RS++ RSHT+K+ + D L Sbjct: 2501 RASTVHARLLSTEEACSLTPPHSA---RSRYGYGARDVRSHTSKAVKHIDSVWEDLL 2554
>FBW1A_HUMAN (Q9Y297) F-box/WD-repeat protein 1A (F-box and WD-repeats protein| beta-TrCP) (E3RSIkappaB) (pIkappaBalpha-E3 receptor subunit) Length = 605 Score = 27.3 bits (59), Expect = 9.3 Identities = 19/45 (42%), Positives = 23/45 (51%) Frame = -1 Query: 274 PGRRRTSEDRELSNTYLSISIYICLNNETVCPVVCL*TAVKTCWC 140 P R+ E L TY S + +CLN ETVC TA+KT C Sbjct: 65 PPRKIIPEKNSLRQTYNSCA-RLCLNQETVCLAS---TAMKTENC 105
>STP2_CANFA (O77645) Nuclear transition protein 2 (TP-2) (TP2)| Length = 129 Score = 27.3 bits (59), Expect = 9.3 Identities = 23/76 (30%), Positives = 29/76 (38%), Gaps = 10/76 (13%) Frame = +1 Query: 16 HRSSTHNS*IVGTEQLSRLQQPHAADPPRSQHNKVH--------TAHRSHTNKSSQQFIG 171 H SS H S Q PH PPR Q + H T H K+ + F G Sbjct: 56 HSSSGHQS-----------QSPHPTLPPRHQKHTRHSHHCPPRPTTHSCSYPKNRKNFEG 104 Query: 172 KL--RDTLSRYLGIYK 213 K+ R + R +YK Sbjct: 105 KVNKRKVVKRSQQVYK 120
>UBQL1_RAT (Q9JJP9) Ubiquilin-1 (Protein linking IAP with cytoskeleton 1)| (PLIC-1) Length = 582 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 365 SEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 267 S MGF +RE N + L GG I A+ L+ + Sbjct: 548 SAMGFLNREANLQALIATGGDINAAIERLLGSQ 580
>UBQL1_MOUSE (Q8R317) Ubiquilin-1 (Protein linking IAP with cytoskeleton 1)| (PLIC-1) Length = 582 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 365 SEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 267 S MGF +RE N + L GG I A+ L+ + Sbjct: 548 SAMGFLNREANLQALIATGGDINAAIERLLGSQ 580
>UBQL1_HUMAN (Q9UMX0) Ubiquilin-1 (Protein linking IAP with cytoskeleton 1)| (PLIC-1) (hPLIC-1) Length = 589 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 365 SEMGFDDRETNKELLAKNGGSIKRAVMDLIARE 267 S MGF +RE N + L GG I A+ L+ + Sbjct: 555 SAMGFLNREANLQALIATGGDINAAIERLLGSQ 587 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,399,755 Number of Sequences: 219361 Number of extensions: 896528 Number of successful extensions: 2564 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 2486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2562 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)