| Clone Name | rbastl22d08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KI13A_HUMAN (Q9H1H9) Kinesin-like protein KIF13A (Kinesin-like p... | 29 | 3.9 | 2 | NIN_HUMAN (Q8N4C6) Ninein (hNinein) | 28 | 8.8 |
|---|
>KI13A_HUMAN (Q9H1H9) Kinesin-like protein KIF13A (Kinesin-like protein RBKIN)| Length = 1805 Score = 28.9 bits (63), Expect = 3.9 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +1 Query: 16 IHEHKEQAEYLKQPTNKIEIMKAPKLT*KTCGEKKICTSLT 138 I E +E+ E L++ ++ E MKAP+L K +K+ LT Sbjct: 367 IRELREEVEKLREQLSQAEAMKAPELKEKLEESEKLIKELT 407
>NIN_HUMAN (Q8N4C6) Ninein (hNinein)| Length = 2090 Score = 27.7 bits (60), Expect = 8.8 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 4 VHHFIHEHKEQAEYLKQPTNKIEIMKAPKL 93 VHH I E K++ +YL+ T +E +KA ++ Sbjct: 1380 VHHVIEECKQENQYLEGNTQLLEKVKAHEI 1409 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,172,612 Number of Sequences: 219361 Number of extensions: 328952 Number of successful extensions: 1037 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)