| Clone Name | rbastl20f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CEMA_CHLRE (Q37050) Chloroplast envelope membrane protein | 30 | 3.0 | 2 | S230_PLAFO (P68875) Transmission-blocking target antigen S230 pr... | 29 | 5.2 | 3 | S230_PLAF7 (P68874) Transmission-blocking target antigen S230 pr... | 29 | 5.2 | 4 | Y1411_SYNY3 (P72725) UPF0272 protein slr1411 | 29 | 5.2 | 5 | PDC2_CANAL (O60035) Protein PDC2 | 28 | 8.8 |
|---|
>CEMA_CHLRE (Q37050) Chloroplast envelope membrane protein| Length = 500 Score = 29.6 bits (65), Expect = 3.0 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +2 Query: 260 HSISQVLLFSCWQLNLYTLLYVLVA*EIQV 349 HSI + F L+L+TLLY+L+ EIQ+ Sbjct: 373 HSIEAITNFFADLLSLFTLLYLLITLEIQI 402
>S230_PLAFO (P68875) Transmission-blocking target antigen S230 precursor| Length = 3135 Score = 28.9 bits (63), Expect = 5.2 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -1 Query: 372 ISFEQHFGT*ISQATNTYNSVYRFSCQQEN 283 ++F+ H+ T ++ +T+NS+ FSC N Sbjct: 2329 LNFKNHYSTAYAKVPDTFNSIINFSCNCYN 2358
>S230_PLAF7 (P68874) Transmission-blocking target antigen S230 precursor| Length = 3135 Score = 28.9 bits (63), Expect = 5.2 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -1 Query: 372 ISFEQHFGT*ISQATNTYNSVYRFSCQQEN 283 ++F+ H+ T ++ +T+NS+ FSC N Sbjct: 2329 LNFKNHYSTAYAKVPDTFNSIINFSCNCYN 2358
>Y1411_SYNY3 (P72725) UPF0272 protein slr1411| Length = 422 Score = 28.9 bits (63), Expect = 5.2 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 6/55 (10%) Frame = +3 Query: 105 NMSH--ELIYRAVTSLGTLDKRKNIAAQMKHVYTV----GPIHVRKNYGALVGKK 251 N +H L++R TSLG +++ A + TV GPI ++ YG GKK Sbjct: 323 NQNHCLNLLFRETTSLGVRVRQQQRYALEREWQTVVIPHGPIRIKVAYGYQAGKK 377
>PDC2_CANAL (O60035) Protein PDC2| Length = 836 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 227 LRCVGWKKRTMHSISQVLLFSCW-QLNLYTLL 319 +R + W R+ HS+S +FS W + +L+ LL Sbjct: 428 IRAIEWITRSWHSVSSERIFSSWKKTHLFNLL 459 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,697,578 Number of Sequences: 219361 Number of extensions: 1268538 Number of successful extensions: 3380 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3380 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)