| Clone Name | rbastl20d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PDLI7_CHICK (Q679P3) PDZ and LIM domain protein 7 (LIM mineraliz... | 30 | 2.0 | 2 | AMP2B_ARATH (Q56Y85) Methionine aminopeptidase 2B (EC 3.4.11.18)... | 29 | 3.4 | 3 | SPB8_BOVIN (Q5BIR5) Serpin B8 | 29 | 3.4 | 4 | AMP2A_ARATH (Q9FV49) Methionine aminopeptidase 2A (EC 3.4.11.18)... | 28 | 4.5 | 5 | SOX30_HUMAN (O94993) Transcription factor SOX-30 | 28 | 5.8 |
|---|
>PDLI7_CHICK (Q679P3) PDZ and LIM domain protein 7 (LIM mineralization protein)| Length = 416 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +1 Query: 136 QNCVHACGDRLCTTLQTMQ 192 QN + ACGDRLC TL Q Sbjct: 67 QNRIRACGDRLCLTLSRAQ 85
>AMP2B_ARATH (Q56Y85) Methionine aminopeptidase 2B (EC 3.4.11.18) (MetAP 2B)| (MAP 2B) (Peptidase M 2B) Length = 439 Score = 28.9 bits (63), Expect = 3.4 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = +3 Query: 105 QSCATIEKNQSKLCSCVR*-----QTMYYTADHAVCQSIVIRPGPPFSE 236 Q ATI KN S L C R +T Y A +C S +++P PP + Sbjct: 362 QLLATINKNFSTLAFCRRYLDRIGETKYLMALKNLCDSGIVQPYPPLCD 410
>SPB8_BOVIN (Q5BIR5) Serpin B8| Length = 374 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 232 ASGAEAVIA*SRICR*SGKFWAGHP 306 A+GA AV+ SR CR KF A HP Sbjct: 328 AAGATAVVRNSRCCRMEPKFCADHP 352
>AMP2A_ARATH (Q9FV49) Methionine aminopeptidase 2A (EC 3.4.11.18) (MetAP 2A)| (MAP 2A) (Peptidase M 2A) Length = 441 Score = 28.5 bits (62), Expect = 4.5 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = +3 Query: 105 QSCATIEKNQSKLCSCVR*-----QTMYYTADHAVCQSIVIRPGPP 227 Q ATI KN S L C R +T Y A +C S +I P PP Sbjct: 364 QLLATINKNFSTLAFCRRYLDRLGETKYLMALKNLCDSGIIEPCPP 409
>SOX30_HUMAN (O94993) Transcription factor SOX-30| Length = 753 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = +1 Query: 73 YSIHEGLMALCNRVRPSRKINQNCVHACGDRLCTTLQTMQY 195 Y HEG+ + NR R + C H+ R C + Y Sbjct: 656 YPKHEGIFSTLNRDYSFRDYSSECTHSENSRSCENMNGTSY 696 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,843,749 Number of Sequences: 219361 Number of extensions: 926079 Number of successful extensions: 1735 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1735 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)