| Clone Name | rbastl20b12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RRP1_DROME (P27864) Recombination repair protein 1 (DNA-(apurini... | 28 | 5.7 | 2 | NELFB_HUMAN (Q8WX92) Negative elongation factor B (NELF-B) (Cofa... | 28 | 5.7 | 3 | Y2507_GLOVI (Q7NHM8) UPF0082 protein glr2507 | 27 | 9.7 | 4 | HAK15_ORYSA (Q7XPL3) Probable potassium transporter 15 (OsHAK15) | 27 | 9.7 |
|---|
>RRP1_DROME (P27864) Recombination repair protein 1 (DNA-(apurinic or| apyrimidinic site) lyase) (EC 4.2.99.18) Length = 679 Score = 28.1 bits (61), Expect = 5.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 266 YHPDWYCLPVNFVGLAV 316 YHP W C+P + G+A+ Sbjct: 479 YHPYWLCMPGGYAGVAI 495
>NELFB_HUMAN (Q8WX92) Negative elongation factor B (NELF-B) (Cofactor of BRCA1)| Length = 580 Score = 28.1 bits (61), Expect = 5.7 Identities = 11/41 (26%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = -2 Query: 179 IVDGMIFF--RRQSKFLSSFIPMSMLLLVDNWTWHISMPFP 63 ++D +F + + + ++ F+PM M LVD++T+++ P Sbjct: 354 MIDSQVFKEPKMEVELITRFLPMLMSFLVDDYTFNVDQKLP 394
>Y2507_GLOVI (Q7NHM8) UPF0082 protein glr2507| Length = 251 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -2 Query: 329 ASPDELRALRSLLASNTNLDDRSRQQATHMLDEEI 225 A PD R + +LL +LDD R A H++++ + Sbjct: 211 ADPDVARQVLTLLEKLESLDDVQRVSANHLVEDAV 245
>HAK15_ORYSA (Q7XPL3) Probable potassium transporter 15 (OsHAK15)| Length = 867 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +1 Query: 94 LSTRSNMLIGIKEERNLLCLLKKIMPSTIQHSVNIYSCQRHCFAISSSSIWVACCL 261 LS S + +GI L ++ ++ I +SV Y+ + FA+ S + CCL Sbjct: 278 LSAVSGLKVGIPNASQGLVVMISVVLLVILYSVQRYATSKMGFALGPSLLIWFCCL 333 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,064,486 Number of Sequences: 219361 Number of extensions: 833085 Number of successful extensions: 2240 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2240 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)