| Clone Name | rbastl20b03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRP8_MOUSE (Q99PV0) Pre-mRNA-processing-splicing factor 8 (Splic... | 80 | 3e-15 | 2 | PRP8_HUMAN (Q6P2Q9) Pre-mRNA-processing-splicing factor 8 (Splic... | 80 | 3e-15 | 3 | PRP8_CAEEL (P34369) Pre-mRNA-splicing factor 8 homolog | 54 | 1e-07 | 4 | PRP8_YEAST (P33334) Pre-mRNA-splicing factor 8 | 50 | 2e-06 | 5 | EX7L_CHLTR (O84333) Probable exodeoxyribonuclease VII large subu... | 30 | 2.3 | 6 | LUC7L_MOUSE (Q9CYI4) Putative RNA-binding protein Luc7-like 1 | 28 | 6.7 |
|---|
>PRP8_MOUSE (Q99PV0) Pre-mRNA-processing-splicing factor 8 (Splicing factor Prp8)| Length = 2335 Score = 79.7 bits (195), Expect = 3e-15 Identities = 32/54 (59%), Positives = 43/54 (79%) Frame = -3 Query: 418 NFMGVKHDPLMKYSMKLGTPRDFYHEDHRPTHFLEFSNIEEGEVAEGDREDTFS 257 NFMGV+HDP MKY ++L P++FYHE HRP+HFL F+ ++EGEV DRED ++ Sbjct: 2282 NFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA 2335
>PRP8_HUMAN (Q6P2Q9) Pre-mRNA-processing-splicing factor 8 (Splicing factor Prp8)| (PRP8 homolog) (220 kDa U5 snRNP-specific protein) (p220) Length = 2335 Score = 79.7 bits (195), Expect = 3e-15 Identities = 32/54 (59%), Positives = 43/54 (79%) Frame = -3 Query: 418 NFMGVKHDPLMKYSMKLGTPRDFYHEDHRPTHFLEFSNIEEGEVAEGDREDTFS 257 NFMGV+HDP MKY ++L P++FYHE HRP+HFL F+ ++EGEV DRED ++ Sbjct: 2282 NFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA 2335
>PRP8_CAEEL (P34369) Pre-mRNA-splicing factor 8 homolog| Length = 2329 Score = 54.3 bits (129), Expect = 1e-07 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = -3 Query: 418 NFMGVKHDPLMKYSMKLGTPRDFYHEDHRPTHFLEFSNIEEG-EVAEGDREDTFS 257 NF G + P MK+ + L P+++YHEDHRP HF F ++ DRED F+ Sbjct: 2275 NFQGQRWSPAMKFDVCLSNPKEYYHEDHRPVHFHNFKAFDDPLGTGSADREDAFA 2329
>PRP8_YEAST (P33334) Pre-mRNA-splicing factor 8| Length = 2413 Score = 50.4 bits (119), Expect = 2e-06 Identities = 23/53 (43%), Positives = 31/53 (58%) Frame = -3 Query: 415 FMGVKHDPLMKYSMKLGTPRDFYHEDHRPTHFLEFSNIEEGEVAEGDREDTFS 257 FMG + Y+ K G P +FY+E HRP HFL+FS + E E ++ D FS Sbjct: 2361 FMGTAFNQEGDYNFKYGIPLEFYNEMHRPVHFLQFSELAGDEELEAEQIDVFS 2413
>EX7L_CHLTR (O84333) Probable exodeoxyribonuclease VII large subunit (EC| 3.1.11.6) (Exonuclease VII large subunit) Length = 516 Score = 30.0 bits (66), Expect = 2.3 Identities = 13/46 (28%), Positives = 28/46 (60%) Frame = +3 Query: 63 LYSTVLEGQAYNTRY*SQETENIIQHVTSKLHTSQSSLFKTEQSSL 200 LY++ L+ + N ++ +Q + NI+ ++ +LH + +S +T Q L Sbjct: 381 LYTSCLKNELLNLQHHTQHSRNILSQLSRRLHIAIASSQQTHQECL 426
>LUC7L_MOUSE (Q9CYI4) Putative RNA-binding protein Luc7-like 1| Length = 371 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 109 SLKRRKTSYNMSRQSYTRHRALYSKLSRAHCR 204 S +RRK S + SR Y RHR+ SR H R Sbjct: 284 SRERRKFSRSRSRDRYRRHRSRSRSHSRGHRR 315 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,730,197 Number of Sequences: 219361 Number of extensions: 821763 Number of successful extensions: 2267 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2266 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)