| Clone Name | rbastl20a09 |
|---|---|
| Clone Library Name | barley_pub |
>BMP15_SHEEP (Q9MZE2) Bone morphogenetic protein 15 precursor (BMP-15)| (Growth/differentiation factor 9B) (GDF-9B) Length = 393 Score = 32.3 bits (72), Expect = 0.28 Identities = 19/47 (40%), Positives = 23/47 (48%) Frame = -2 Query: 186 HVGSHFWNCKVRGSK*CRSST*LRLFFYCTRLEGKKKVLNLYWHGTA 46 HVG WN K R LRL F C + G + VL +WHGT+ Sbjct: 188 HVGQKLWNHKGRRV--------LRLRFVCQQPRGSE-VLEFWWHGTS 225
>MED12_HUMAN (Q93074) Mediator of RNA polymerase II transcription subunit 12| (Thyroid hormone receptor-associated protein complex 230 kDa component) (Trap230) (Activator-recruited cofactor 240 kDa component) (ARC240) (CAG repeat protein 45) (OPA-containin Length = 2212 Score = 31.2 bits (69), Expect = 0.63 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +3 Query: 9 QSFCILPTTSLPVPCRANTNSTPFSFLLV 95 QS LPTT P P ++T STPFS LL+ Sbjct: 358 QSTSTLPTTPAPQPPTSSTPSTPFSDLLM 386
>VE1_BPV4 (P08344) Replication protein E1 (EC 3.6.1.-) (ATP-dependent| helicase E1) Length = 608 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -2 Query: 249 GDNSMVDSFRFVSEKKLSSFVHVGSHFWNCKVRGSK 142 G + V SF + K+ SFV+ SHFW +RG+K Sbjct: 442 GKSMFVMSFMKALQGKVLSFVNSKSHFWLQPLRGAK 477
>EI2BE_HUMAN (Q13144) Translation initiation factor eIF-2B epsilon subunit| (eIF-2B GDP-GTP exchange factor) Length = 721 Score = 28.1 bits (61), Expect = 5.3 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 4/77 (5%) Frame = -3 Query: 329 RHDNGQPDAGGGGAELLPQHPPTPRAAVII--PWWTRFVSFQKKNYLVLFMWVPIFGIVK 156 R G +GGGGA + PP P AV++ + RF K VL + ++ Sbjct: 19 RSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPLANV-ALID 77 Query: 155 Y--EVVSDVGVALDYVF 111 Y E ++ GV +VF Sbjct: 78 YTLEFLTATGVQETFVF 94
>DX26B_HUMAN (Q5JSJ4) Protein DDX26B| Length = 861 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/37 (29%), Positives = 25/37 (67%) Frame = +3 Query: 264 RRVLGKELGSSSSRIRLPIIMSWDRTVPDRAPAGENG 374 +R+L + L S +++ +++++++T PD P GE+G Sbjct: 213 QRMLNQCLESLVQKVQSGVVINFEKTGPDPLPIGEDG 249
>VE1_HPV41 (P27551) Replication protein E1 (EC 3.6.1.-) (ATP-dependent| helicase E1) Length = 614 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 195 SFVHVGSHFWNCKVRGSK*C 136 SFV GSHFW +RG++ C Sbjct: 466 SFVSNGSHFWLSPLRGARCC 485
>DDHA_RHOSU (Q8GPG4) Dimethylsulfide dehydrogenase alpha subunit precursor (EC| 1.8.-.-) (Dimethylsulfide dehydrogenase molybdenum subunit) (DMS DH alpha subunit) (DMS DH molybdenum subunit) Length = 910 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +2 Query: 197 DNFFSETKRNESTMELSPQLGVSEGVGEGARL 292 + F +R E + +SPQL ++G+ +GA++ Sbjct: 795 NKFMLRLQRGEPNIYISPQLAAAKGIADGAQV 826
>CP2C6_RAT (P05178) Cytochrome P450 2C6 (EC 1.14.14.1) (CYPIIC6) (P450 PB1)| (PTF2) Length = 490 Score = 27.7 bits (60), Expect = 6.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 99 YSKKKDVIKCYSYITYYLVLYNSKNGNPHEQ 191 + + DV +I YYL+ + +N NPH + Sbjct: 251 HQESLDVTNPRDFIDYYLIKWKQENHNPHSE 281 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,997,679 Number of Sequences: 219361 Number of extensions: 1092104 Number of successful extensions: 3023 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2951 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3019 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)