| Clone Name | rbastl20a08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AROB_CLOTE (Q894C9) 3-dehydroquinate synthase (EC 4.2.3.4) | 29 | 2.7 | 2 | MCE1_YEAST (Q01159) mRNA capping enzyme alpha subunit (mRNA guan... | 29 | 3.5 | 3 | EF2_METVA (P09604) Elongation factor 2 (EF-2) | 28 | 5.9 | 4 | EF2_METMP (Q6LXI2) Elongation factor 2 (EF-2) | 28 | 5.9 | 5 | WRK19_ARATH (Q9SZ67) Probable WRKY transcription factor 19 (WRKY... | 28 | 5.9 |
|---|
>AROB_CLOTE (Q894C9) 3-dehydroquinate synthase (EC 4.2.3.4)| Length = 373 Score = 29.3 bits (64), Expect = 2.7 Identities = 25/101 (24%), Positives = 41/101 (40%), Gaps = 18/101 (17%) Frame = +3 Query: 36 TLGVSVRQTCRQDITHNYFIEKGSVNVLKMSNH----------------KQFALPT--NE 161 T+G ++ T + ITH + G + LK+S H K+ LPT Sbjct: 263 TIGHAIEMTSKNKITHGEAVALGMLVSLKLSEHIYGLDKNLYYRMEKLYKKLGLPTKYKV 322 Query: 162 *HARLSSYNIGTERINLKSILFVSTTDFFLEHIKLSPDEVE 284 + L Y I ++ N +I FV D +K+ ++ E Sbjct: 323 DNYNLFMYAINHDKKNKDNIRFVLLKDVEKPEVKIEVNKEE 363
>MCE1_YEAST (Q01159) mRNA capping enzyme alpha subunit (mRNA| guanylyltransferase) (EC 2.7.7.50) (GTP--RNA guanylyltransferase) (GTase) Length = 459 Score = 28.9 bits (63), Expect = 3.5 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -2 Query: 286 PSTSSG-DSLMCSKKKSVVETNKIDFKLIRSVPMLYEESL 170 P T+ G DSL+ K + N +DFKLI +PM+ + SL Sbjct: 235 PYTAGGKDSLLLKWKPE--QENTVDFKLILDIPMVEDPSL 272
>EF2_METVA (P09604) Elongation factor 2 (EF-2)| Length = 727 Score = 28.1 bits (61), Expect = 5.9 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = +3 Query: 210 LKSILFVSTTDFFLEHIKLSPDEVEG 287 +K +LF++ D + +KL+P+E++G Sbjct: 141 VKPVLFINKVDRLINELKLTPEELQG 166
>EF2_METMP (Q6LXI2) Elongation factor 2 (EF-2)| Length = 727 Score = 28.1 bits (61), Expect = 5.9 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = +3 Query: 210 LKSILFVSTTDFFLEHIKLSPDEVEG 287 +K +LF++ D + +KL+P+E++G Sbjct: 141 VKPVLFINKVDRLINELKLTPEELQG 166
>WRK19_ARATH (Q9SZ67) Probable WRKY transcription factor 19 (WRKY DNA-binding| protein 19) Length = 1895 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +3 Query: 147 LPTNE*HARLSSYNIGTERI-NLKSILFVSTTDFFLEHIKLSPDE 278 +P ++ + YNIGT ++ + IL + DF L +K++P+E Sbjct: 1820 IPYSDLEIGTALYNIGTGKLPKIPDILSLDARDFILTCLKVNPEE 1864 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,631,132 Number of Sequences: 219361 Number of extensions: 687790 Number of successful extensions: 1359 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1359 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)