| Clone Name | rbastl19g05 |
|---|---|
| Clone Library Name | barley_pub |
>LPAT1_ARATH (Q8GXU8) 1-acyl-sn-glycerol-3-phosphate acyltransferase 1,| chloroplast precursor (EC 2.3.1.51) (Lysophosphatidyl acyltransferase 1) Length = 356 Score = 30.8 bits (68), Expect = 0.98 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -3 Query: 237 LSCLGRCFSLLKRGLRFFFIFPEG 166 + CL RC LLK+G FF FPEG Sbjct: 253 VDCLKRCMELLKKGASVFF-FPEG 275
>LPXB_PSESM (Q886N0) Lipid-A-disaccharide synthase (EC 2.4.1.182)| Length = 380 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 145 VWCWRHTEVLRKNIGCLLLYTVLLMAYPCFRKKG 44 VW WR VL+ GC L+ T+L + +KG Sbjct: 123 VWAWRQKRVLKIREGCDLMLTLLPFEARFYEEKG 156
>LPAT1_BRANA (Q9LLY4) 1-acyl-sn-glycerol-3-phosphate acyltransferase 1,| chloroplast precursor (EC 2.3.1.51) Length = 344 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 237 LSCLGRCFSLLKRGLRFFFIFPEG 166 + CL RC L+K+G FF FPEG Sbjct: 239 VDCLKRCMELVKKGASVFF-FPEG 261
>SPL12_ARATH (Q9S7P5) Squamosa promoter-binding-like protein 12| Length = 927 Score = 28.9 bits (63), Expect = 3.7 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +2 Query: 41 FSFLSETRISHEKYCIQKKTTYILSEHLCVPPTPYMLLS-FGIPSGKMKKNLNPL 202 F FL E + E C+ KK IL E V P+P LS + ++KN P+ Sbjct: 675 FKFLIEFSMDREWCCVMKKLLNILFEEGTVDPSPDAALSELCLLHRAVRKNSKPM 729
>LPXB_PSEPK (Q88MG7) Lipid-A-disaccharide synthase (EC 2.4.1.182)| Length = 375 Score = 28.1 bits (61), Expect = 6.3 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 145 VWCWRHTEVLRKNIGCLLLYTVLLMAYPCFRKKG 44 VW WR VL+ GC L+ T+L + ++G Sbjct: 122 VWAWRQKRVLKIREGCDLMLTLLPFEARFYEEQG 155 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,990,979 Number of Sequences: 219361 Number of extensions: 661896 Number of successful extensions: 1873 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1873 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)