| Clone Name | rbastl19d07 |
|---|---|
| Clone Library Name | barley_pub |
>GRN_HUMAN (P28799) Granulins precursor (Proepithelin) (PEPI) [Contains:| Acrogranin; Paragranulin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B); Granulin-4 (Granulin A); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granul Length = 593 Score = 29.3 bits (64), Expect = 2.7 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -2 Query: 281 EGSFCSVE---DRGVMTYECLSGLIQKWPSAVGLNL 183 +G FC V D G +Y C L+ KWP+ + +L Sbjct: 22 DGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHL 57
>FXL19_MOUSE (Q6PB97) F-box/LRR-repeat protein 19 (F-box and leucine-rich repeat| protein 19) Length = 674 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 164 AISLLTANLNPQPMAIFELSRIGTHKS*PLCLPHYRRTP 280 ++ LLTA +P + L+ G H+ CLP +RR P Sbjct: 594 SVHLLTAPTSPLRETLVHLNLAGCHRLTDHCLPLFRRCP 632
>FXL19_HUMAN (Q6PCT2) F-box/LRR-repeat protein 19 (F-box and leucine-rich repeat| protein 19) Length = 674 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 164 AISLLTANLNPQPMAIFELSRIGTHKS*PLCLPHYRRTP 280 ++ LLTA +P + L+ G H+ CLP +RR P Sbjct: 594 SVHLLTAPTSPLRETLVHLNLAGCHRLTDHCLPLFRRCP 632
>OXAA_XYLFT (Q879S3) Inner membrane protein oxaA| Length = 565 Score = 28.5 bits (62), Expect = 4.6 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = -2 Query: 251 GVMTYECLSGLIQKWPSAVGLNLQSGEKLLR*WQMRKNVSLQRKRKR 111 GVM SGL W GLNL L++ W +R++ RKR R Sbjct: 520 GVMMAFVPSGLALYWVINGGLNL-----LIQWWMIRQHADFSRKRSR 561
>OXAA_XYLFA (Q9P9U1) Inner membrane protein oxaA| Length = 565 Score = 28.5 bits (62), Expect = 4.6 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = -2 Query: 251 GVMTYECLSGLIQKWPSAVGLNLQSGEKLLR*WQMRKNVSLQRKRKR 111 GVM SGL W GLNL L++ W +R++ RKR R Sbjct: 520 GVMMAFVPSGLALYWVINGGLNL-----LIQWWMIRQHADFSRKRSR 561
>RNS2_PYRPY (Q40965) Ribonuclease S-2 precursor (EC 3.1.27.1) (S2-RNase)| Length = 221 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +2 Query: 74 IFLVGMIFTLRTIFFSSSARKHSYAFAISAAISLLTANLNPQP 202 I++ M+F+L + SSSA ++ Y F + N NP P Sbjct: 2 IYIFTMVFSLNVLILSSSAARYDY-FQFTQQYQQAFCNSNPTP 43
>MTR1A_SHEEP (P48040) Melatonin receptor type 1A (Mel-1A-R) (Mel1a melatonin| receptor) Length = 366 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/59 (22%), Positives = 30/59 (50%) Frame = +2 Query: 56 LVETMHIFLVGMIFTLRTIFFSSSARKHSYAFAISAAISLLTANLNPQPMAIFELSRIG 232 L+ T+ + +VG + + +++ + R F +S A++ L + P P+A+ + G Sbjct: 50 LIFTIVVDIVGNLLVVLSVYRNKKLRNAGNVFVVSLAVADLLVAVYPYPLALASIVNNG 108
>MOK_MOUSE (Q9WVS4) MAPK/MAK/MRK overlapping kinase (EC 2.7.11.22) (MOK| protein kinase) Length = 420 Score = 27.7 bits (60), Expect = 7.9 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 107 TIFFSSSARKHSYAFAISAAISLLTANLNPQPMAI 211 T F S A + F + I LLTANL+PQ +++ Sbjct: 227 TKFKQSRAMSFDFPFKKGSGIPLLTANLSPQCLSL 261 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,924,068 Number of Sequences: 219361 Number of extensions: 803303 Number of successful extensions: 1935 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1881 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1935 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)