| Clone Name | rbastl18f01 |
|---|---|
| Clone Library Name | barley_pub |
>PRKDC_CHICK (Q8QGX4) DNA-dependent protein kinase catalytic subunit (EC 2.7.11.1)| (DNA-PK catalytic subunit) (DNA-PKcs) Length = 4134 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +1 Query: 178 Y*SRRLHPM-LWQTMATSPCHVKDKLQNSYIC 270 Y ++ PM +W + T+ C DKLQ ++C Sbjct: 3175 YPDAKMDPMNIWDDIITNRCFFLDKLQEKFLC 3206
>R1AB_IBVBC (Q91QT2) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p87; p195 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); Peptide HD2 (p41); 3C-like proteinase (EC 3.4.22.-) (3CL- Length = 6629 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 160 SCGLRVY*SRRLHPMLWQTMATSPCHVKDKLQNSYICSAN 279 +CG++ Y R L + AT+ H K + N C AN Sbjct: 1354 NCGIKSYELRGLEACIQPVRATNLLHFKTQYSNCPTCGAN 1393
>R1AB_IBVB (P27920) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p87; p195 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); Peptide HD2 (p41); 3C-like proteinase (EC 3.4.22.-) (3CL-P Length = 6629 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 160 SCGLRVY*SRRLHPMLWQTMATSPCHVKDKLQNSYICSAN 279 +CG++ Y R L + AT+ H K + N C AN Sbjct: 1354 NCGIKSYELRGLEACIQPVRATNLLHFKTQYSNCPTCGAN 1393
>SAHH_BRAJA (Q89HP6) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 473 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +1 Query: 148 SDETSCGL-RVY*SRRLHPMLWQTMATSPCHVKDKLQNSYICSANLL 285 S+ET+ G+ R+Y ++ +LW + + K K N Y C +L+ Sbjct: 195 SEETTTGVHRLYDMQKAGTLLWPAINVNDSVTKSKFDNLYGCRESLV 241
>PAND_METCA (Q605G8) Aspartate 1-decarboxylase precursor (EC 4.1.1.11)| (Aspartate alpha-decarboxylase) [Contains: Aspartate 1-decarboxylase beta chain; Aspartate 1-decarboxylase alpha chain] Length = 126 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -1 Query: 230 GDVAIVCHSIGCNXXXXXXLRPQLVSSED*KQSVIHQH 117 GD+ I+C +G N RP LV ++ Q H Sbjct: 82 GDIVIICAYVGLNQAELAAYRPNLVYVDENNQITRTSH 119
>MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich protein| Length = 145 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 372 CLPTHCTCDQWSSRCCTIRGIC*QSKC 292 C PT CTC CC C Q C Sbjct: 78 CCPTKCTCCPKKCTCCPQPTCCVQPTC 104
>VE6_HPV61 (Q80948) Protein E6| Length = 146 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 360 HCTCDQWSSRCCTIRGIC 307 H QW+ RCC RG C Sbjct: 123 HYIAGQWTGRCCQCRGPC 140 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,133,706 Number of Sequences: 219361 Number of extensions: 1029559 Number of successful extensions: 2271 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2270 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)