| Clone Name | rbastl18d09 |
|---|---|
| Clone Library Name | barley_pub |
>GYS2_HUMAN (P54840) Glycogen [starch] synthase, liver (EC 2.4.1.11)| Length = 703 Score = 30.0 bits (66), Expect = 1.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 238 RFGVIILYPPTTRSYSYTKPLAAPPLP 318 +F V + PPTT + Y +P + PP P Sbjct: 620 KFHVELTSPPTTEGFKYPRPSSVPPSP 646
>CYSG_BUCAI (P57500) Siroheme synthase [Includes: Uroporphyrin-III| C-methyltransferase (EC 2.1.1.107) (Urogen III methylase) (SUMT) (Uroporphyrinogen III methylase) (UROM); Precorrin-2 dehydrogenase (EC 1.3.1.76); Sirohydrochlorin ferrochelatase (EC 4.99. Length = 473 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +1 Query: 73 DHYLHKW-ILSRDAYTILQY*ASSKAIWKLQRLCT 174 D +L+ W ILS +YT++ Y + KA++ Q+L T Sbjct: 362 DGFLNNWSILSDPSYTLVVYMGTLKAVYIAQKLIT 396
>UVRC_CHLAB (Q5L553) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 604 Score = 27.3 bits (59), Expect = 9.6 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = -2 Query: 229 TVYCSKYMEYVLTNSRIHACTTVATSKWPWS*LSTVV*YKHPVTRSICEDNDH 71 T Y + + N+++HA TT+ +S P+ L ++ R C DN H Sbjct: 343 TGYGRELLNLAKNNAQVHAETTIQSSALPYEELKKILKSPDYPYRIECYDNAH 395
>UBR1_SCHPO (O60152) Ubiquitin-protein ligase E3 component N-recognin-1 (EC| 6.-.-.-) (N-end-recognizing protein) Length = 1958 Score = 27.3 bits (59), Expect = 9.6 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 6/43 (13%) Frame = +3 Query: 87 QMDLVTGCLYYTTVLS*L----QGHLE--VATVVHACILELVS 197 Q D G L++T V + + QG LE V T +HAC+L L+S Sbjct: 979 QSDSFVGILWHTIVYAYIYPYDQGKLEGLVNTALHACLLVLMS 1021
>ENV_SRV1 (P04027) Env polyprotein precursor (Coat polyprotein) [Contains:| Coat protein GP70; Coat protein GP20] Length = 587 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 235 LVTVYCSKYMEYVLTNSRIHACTTVATSKWP 143 L TV CS Y Y +TNS C + T+ P Sbjct: 57 LTTVSCSTYTAYSVTNSLKWQCVSTPTTASP 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,599,033 Number of Sequences: 219361 Number of extensions: 852944 Number of successful extensions: 2516 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2513 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)