| Clone Name | rbastl18c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CAND_DROME (P27398) Calpain D (EC 3.4.22.-) (Calcium-activated n... | 29 | 3.6 | 2 | NPBW2_HUMAN (P48146) Neuropeptides B/W receptor type 2 (G-protei... | 28 | 8.0 | 3 | KCAB3_HUMAN (O43448) Voltage-gated potassium channel beta-3 subu... | 28 | 8.0 |
|---|
>CAND_DROME (P27398) Calpain D (EC 3.4.22.-) (Calcium-activated neutral| proteinase D) (CANP D) (Small optic lobes protein) Length = 1594 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 23 RHQSVAASLGTQHPRCPTGHQRGHYYHHYI 112 R Q +A SLG + H H++HHY+ Sbjct: 176 RGQDLAGSLGNRGELLAADHSHPHHHHHYL 205
>NPBW2_HUMAN (P48146) Neuropeptides B/W receptor type 2 (G-protein coupled| receptor 8) Length = 333 Score = 27.7 bits (60), Expect = 8.0 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 109 VVMVVVAPLMTCWTPGMLCS*ACCHTLVPQ 20 +V+VV+A + CWTP L S T +PQ Sbjct: 261 LVLVVLAVCLLCWTPFHLASVVALTTDLPQ 290
>KCAB3_HUMAN (O43448) Voltage-gated potassium channel beta-3 subunit (K(+)| channel beta-3 subunit) (Kv-beta-3) Length = 404 Score = 27.7 bits (60), Expect = 8.0 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -1 Query: 78 PVGH-LGCCVPKLAATLWCLRTFGYDS 1 PV H LGC V +LA WCLR+ G S Sbjct: 335 PVAHQLGCTVAQLAIA-WCLRSEGVSS 360 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,733,065 Number of Sequences: 219361 Number of extensions: 724046 Number of successful extensions: 2157 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2097 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2151 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)