| Clone Name | rbastl17h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TPC1_ORYSA (Q5QM84) Probable voltage-dependent calcium channel p... | 29 | 2.6 | 2 | YFK5_SCHPO (P87132) Hypothetical protein C167.05 in chromosome I | 28 | 7.7 | 3 | ADAM2_BOVIN (O77780) ADAM 2 precursor (A disintegrin and metallo... | 27 | 10.0 |
|---|
>TPC1_ORYSA (Q5QM84) Probable voltage-dependent calcium channel protein TPC1| (Probable voltage-gated calcium channel) (Two-pore calcium channel protein) Length = 757 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = -1 Query: 253 ATLSLKSNYMYTSEHFCIYCKTIVTSEGK--LPAYLQRYPT 137 A L ++ TSE F C TI K P+YL++YP+ Sbjct: 398 AELDQSGDFKVTSEEFATLCNTIAIKFQKEPPPSYLEKYPS 438
>YFK5_SCHPO (P87132) Hypothetical protein C167.05 in chromosome I| Length = 601 Score = 27.7 bits (60), Expect = 7.7 Identities = 18/57 (31%), Positives = 25/57 (43%) Frame = +1 Query: 67 KSSKVDLNVMYLTVNALSYMDPTEWGTFANKQAICLQR*QWFCSKYKNVRLCTYNLT 237 KS KVD+ PT W AN+ C++R + + + R CTY LT Sbjct: 393 KSMKVDIG-------------PTRWIPTANRTIRCIRRGDFQTAASSSKRNCTYFLT 436
>ADAM2_BOVIN (O77780) ADAM 2 precursor (A disintegrin and metalloproteinase| domain 2) (Fertilin beta subunit) (PH-30) (PH30) (PH30-beta) Length = 745 Score = 27.3 bits (59), Expect = 10.0 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 3/57 (5%) Frame = +1 Query: 142 GTFANKQAICLQR*QWFCSKYKNVRLCTYNLTSVKALLQGKCF---HCHCNRLFLAP 303 GT + IC Q Q S + N Y+ K QG C HCHCN +L P Sbjct: 591 GTVCGESKIC-QNKQCVDSSFLN-----YDCNPEKCNNQGVCNNKKHCHCNPSYLPP 641 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,190,096 Number of Sequences: 219361 Number of extensions: 915835 Number of successful extensions: 2166 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2166 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)