| Clone Name | rbastl17g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1317_HAEIN (P44160) Hypothetical UPF0010 protein HI1317 | 28 | 5.5 | 2 | PYRX_SYNY3 (P72934) Probable dihydroorotase-like protein (Aspart... | 28 | 7.2 | 3 | PGS1_SACPS (P79001) CDP-diacylglycerol--glycerol-3-phosphate 3-p... | 28 | 7.2 | 4 | RGA2_SCHPO (Q10164) Probable Rho-type GTPase-activating protein 2 | 27 | 9.4 |
|---|
>Y1317_HAEIN (P44160) Hypothetical UPF0010 protein HI1317| Length = 271 Score = 28.1 bits (61), Expect = 5.5 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 3 FSRKIPLKKQQVPSFSLWNNCE*EPSG---TRNQKMLTLET 116 F+R I L F LWN + SG T QKML LET Sbjct: 210 FNRTIALHHHNASQFVLWNPWHKKTSGMSETGYQKMLCLET 250
>PYRX_SYNY3 (P72934) Probable dihydroorotase-like protein (Aspartate| carbamoyltransferase 42 kDa non-catalytic chain) Length = 441 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +2 Query: 164 MNRPETHCWLV*GPIKDKQLLQENEMQTSAHHQPINSPVEFNQPTTA 304 +++P+T WL KQ L + E +AHHQP P N+P +A Sbjct: 102 LDQPQTLQWL-------KQRLNQIE-GVNAHHQPPGDPQAENRPDSA 140
>PGS1_SACPS (P79001) CDP-diacylglycerol--glycerol-3-phosphate| 3-phosphatidyltransferase (EC 2.7.8.5) (Phosphatidylglycerophosphate synthase) (PGP synthase) Length = 521 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 206 IKDKQLLQENEMQTSAHHQPINSPVEFN 289 +++ L EN +Q S H+QPI+ P +F+ Sbjct: 267 LREASQLLENFLQISKHNQPISPPGQFS 294
>RGA2_SCHPO (Q10164) Probable Rho-type GTPase-activating protein 2| Length = 1275 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 239 MQTSAHHQPINSPVEFNQPTTASLPIKDIFASKQ 340 + TS+ +PI P FN + S+ KD ++KQ Sbjct: 277 LNTSSFRRPITKPTPFNSDSNISIDPKDNNSNKQ 310 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,425,317 Number of Sequences: 219361 Number of extensions: 905773 Number of successful extensions: 1728 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1728 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)