| Clone Name | rbastl17d11 |
|---|---|
| Clone Library Name | barley_pub |
>HETM_ANASP (P37693) Polyketide synthase hetM| Length = 506 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 196 HRERLVGGYPLAGGPRGH-FLGRGVDTCLNIGCFPHLE 86 HR L+GG G H F+ V CL +GCFP +E Sbjct: 323 HRPPLIGGDSETGIGNTHDFINLMVKGCLQMGCFPDVE 360
>ATS6_HUMAN (Q9UKP5) ADAMTS-6 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 6) (ADAM-TS 6) (ADAM-TS6) Length = 860 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 206 DCIPSGTTSWGLPPGWGTPWTLSWAWC 126 DC+P GT + GWG PW+L W C Sbjct: 498 DCVPFGTWPQSIDGGWG-PWSL-WGEC 522
>CGRE1_RAT (P97586) Cell growth regulator with EF hand domain 1 (Cell growth| regulatory gene 11 protein) Length = 281 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 157 PQPGGNPQLVVPDGIQSMTQISIGQVGKLGSQIE 258 PQP G+ L+ +QS TQ S+G ++ SQ+E Sbjct: 161 PQPAGSQPLLANSPLQSETQQSLGTKEEITSQVE 194
>EP400_HUMAN (Q96L91) E1A-binding protein p400 (EC 3.6.1.-) (p400 kDa| SWI2/SNF2-related protein) (Domino homolog) (hDomino) (CAG repeat protein 32) (Trinucleotide repeat-containing gene 12 protein) Length = 3160 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 157 PQPGGNPQLVVPDGIQSMTQISIGQVGKLGSQIEFLPRKPLSIPPAS 297 P P + VP G+ S+ S+G G ++ +P+K IPPAS Sbjct: 317 PPPTSPSRTAVPPGLSSLPLTSVGNTG-----MKKVPKKLEEIPPAS 358
>ISPH_RHILO (Q985W3) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (EC| 1.17.1.2) Length = 336 Score = 28.5 bits (62), Expect = 4.2 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 7/61 (11%) Frame = +1 Query: 187 VPDGIQSMTQISIGQVGKLGSQIEFLP------RKPLSIPPASMGNSFFYLAGTC-MVSK 345 V +G+QS+ + I ++ ++ ++ P P S+P + + FYL TC +VSK Sbjct: 54 VVEGLQSLGAVFIEELSEIPAEHRRSPVVFSAHGVPKSVPADAQARNLFYLDATCPLVSK 113 Query: 346 V 348 V Sbjct: 114 V 114
>GLMS_LISMO (Q8Y915) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 600 Score = 28.5 bits (62), Expect = 4.2 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +3 Query: 3 DEYL*RRVNHVVSCHTGYHLQKVKKKKPSRCGKHPMFRHVS 125 DE L H+V+C T YH V K + K P+ HVS Sbjct: 283 DEILSSDRIHIVACGTSYHAGLVGKNLIEKMAKIPVEVHVS 323
>GLMS_LISMF (Q722H1) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 600 Score = 28.5 bits (62), Expect = 4.2 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +3 Query: 3 DEYL*RRVNHVVSCHTGYHLQKVKKKKPSRCGKHPMFRHVS 125 DE L H+V+C T YH V K + K P+ HVS Sbjct: 283 DEILSSDRIHIVACGTSYHAGLVGKNLIEKMAKIPVEVHVS 323
>GLMS_LISIN (Q92DS8) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 600 Score = 28.5 bits (62), Expect = 4.2 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +3 Query: 3 DEYL*RRVNHVVSCHTGYHLQKVKKKKPSRCGKHPMFRHVS 125 DE L H+V+C T YH V K + K P+ HVS Sbjct: 283 DEILSSDRIHIVACGTSYHAGLVGKNLIEKMAKIPVEVHVS 323
>CGRE1_MOUSE (Q8R1U2) Cell growth regulator with EF hand domain 1 (Cell growth| regulatory gene 11 protein) Length = 281 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 157 PQPGGNPQLVVPDGIQSMTQISIGQVGKLGSQIE 258 PQP G+ L+ +QS TQ S+G ++ Q+E Sbjct: 160 PQPAGSQPLLANSPLQSETQQSLGTKEEIRGQVE 193
>YCE2_YEAST (P25572) Hypothetical protein YCL042W| Length = 119 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -1 Query: 200 IPSGTTSWGLPPGWGTPWTLSWAWCRHMSEHWVLSAPRRF 81 I SG + G P G LSWAWC + W L R + Sbjct: 15 IISGVPTDGQPLSGGP---LSWAWCHTTLKRWALMKTRPY 51
>RL20_LISMO (P66103) 50S ribosomal protein L20| Length = 119 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -3 Query: 282 RKWFSRQKLNLAAELTDLTY*DLRHGLYSIGND 184 R W +R +N AA + DL+Y L HGL G D Sbjct: 59 RLWIAR--INAAARMQDLSYSKLMHGLKLAGID 89
>RL20_LISMF (Q71YN5) 50S ribosomal protein L20| Length = 119 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -3 Query: 282 RKWFSRQKLNLAAELTDLTY*DLRHGLYSIGND 184 R W +R +N AA + DL+Y L HGL G D Sbjct: 59 RLWIAR--INAAARMQDLSYSKLMHGLKLAGID 89
>RL20_LISIN (P66104) 50S ribosomal protein L20| Length = 119 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -3 Query: 282 RKWFSRQKLNLAAELTDLTY*DLRHGLYSIGND 184 R W +R +N AA + DL+Y L HGL G D Sbjct: 59 RLWIAR--INAAARMQDLSYSKLMHGLKLAGID 89
>GBPA_SHEON (Q8EHY2) GlcNac-binding protein A precursor| Length = 475 Score = 28.1 bits (61), Expect = 5.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 203 CIPSGTTSWGLPPGWGTPWTLSW 135 C+ T+ G PG G WT++W Sbjct: 450 CVQWSPTATGFEPGIGNSWTMAW 472
>SIVA_MOUSE (O54926) Apoptosis regulatory protein Siva (CD27-binding protein)| (CD27BP) Length = 175 Score = 27.7 bits (60), Expect = 7.2 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +1 Query: 115 DMCLHHAQES----VHGVPQPGGNPQLVVPDGIQSMTQISIGQVG 237 D ++H QES V G PQP L+ PDG + Q + G Sbjct: 61 DCSVNHLQESLKSGVVGAPQPARGQMLIGPDGRLTRCQAQASEGG 105
>CH60_BACHD (O50305) 60 kDa chaperonin (Protein Cpn60) (groEL protein)| Length = 544 Score = 27.7 bits (60), Expect = 7.2 Identities = 16/62 (25%), Positives = 32/62 (51%) Frame = +1 Query: 73 KRKNLLGAESTQCSDMCLHHAQESVHGVPQPGGNPQLVVPDGIQSMTQISIGQVGKLGSQ 252 K ++ G +T + + +E + V G NP +V+ GI+ TQ+++ ++ K+ Sbjct: 79 KTNDIAGDGTTTATVLAQAMIREGLKNVTS-GANP-MVIRKGIEKATQVAVEELSKISKP 136 Query: 253 IE 258 IE Sbjct: 137 IE 138
>PAR3L_HUMAN (Q8TEW8) Amyotrophic lateral sclerosis 2 chromosome region| candidate gene 19 protein (Partitioning-defective 3-like protein) (PAR3-L protein) (PAR3-beta) Length = 1205 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +1 Query: 136 QESVHGVPQPGGNP-QLVVPDGIQSMTQISIGQVGKLGSQIEFLP 267 QE +H + P GNP PD ++ + +G +IE P Sbjct: 82 QEPLHKIESPSGNPADRQSPDAFETEVAAQLAAFKPIGGEIEVTP 126
>R3HD2_MOUSE (Q80TM6) R3H domain-containing protein 2| Length = 1044 Score = 27.3 bits (59), Expect = 9.4 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +1 Query: 133 AQESVHGVPQPGGNPQL--VVPDGIQSMTQISIGQVGKLGSQIEFLPRKPLSIPPASMGN 306 A +SV G GG P ++P Q+ T S+G + GS+ +P+ P P M Sbjct: 702 ASQSVQGGLPTGGVPVYYSMIPPAQQNGTSPSVGFLQPPGSEQYQMPQSPSPCSPPQMSQ 761 Query: 307 SF 312 + Sbjct: 762 QY 763 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,471,191 Number of Sequences: 219361 Number of extensions: 1210137 Number of successful extensions: 4238 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 4153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4234 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)