| Clone Name | rbastl17d02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KGX15_CENLL (Q86QV0) Potassium channel toxin gamma-KTx 1.5 (Ergt... | 28 | 6.0 | 2 | KGX14_CENSC (Q86QU6) Potassium channel toxin gamma-KTx 1.4 (Ergt... | 28 | 7.8 |
|---|
>KGX15_CENLL (Q86QV0) Potassium channel toxin gamma-KTx 1.5 (Ergtoxin-like| protein 1) (ErgTx1) (CllErg1) (CllErgTx1) Length = 42 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -1 Query: 120 SCYQTSRFTRHAQHHLLHDAFTTKIGHRGIECMFYVC 10 SC SR +++ + D K GH G CMF+ C Sbjct: 4 SCVDKSRCSKYGYYQECQDC-CKKAGHNGGTCMFFKC 39
>KGX14_CENSC (Q86QU6) Potassium channel toxin gamma-KTx 1.4 (Ergtoxin-like| protein 1) (ErgTx1) (CsErg1) (CsErgTx1) Length = 42 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -1 Query: 120 SCYQTSRFTRHAQHHLLHDAFTTKIGHRGIECMFYVC 10 SC SR ++ + D K GH G CMF+ C Sbjct: 4 SCVDKSRCAKYGYYQECQDC-CKKAGHNGGTCMFFKC 39 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,225,257 Number of Sequences: 219361 Number of extensions: 785277 Number of successful extensions: 1370 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1370 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)