| Clone Name | rbastl17c11 |
|---|---|
| Clone Library Name | barley_pub |
>ZNHI2_MOUSE (Q9QY66) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 399 Score = 29.3 bits (64), Expect = 2.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -2 Query: 301 LRMDIPSKLFSYEHTAVLFHG 239 +R +P+ LF+Y HT L+HG Sbjct: 206 VRFQLPNVLFAYAHTLALYHG 226
>ZNHI2_HUMAN (Q9UHR6) Zinc finger HIT domain-containing protein 2 (Protein FON)| Length = 403 Score = 29.3 bits (64), Expect = 2.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -2 Query: 301 LRMDIPSKLFSYEHTAVLFHG 239 +R +P+ LF+Y HT L+HG Sbjct: 211 VRFQLPNVLFAYAHTLALYHG 231
>YFC3_SCHPO (O14138) Hypothetical protein C25A8.03c in chromosome I| Length = 467 Score = 28.1 bits (61), Expect = 5.4 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = -3 Query: 258 QLCCFMEVSVNCIVLLLCYFYFTVFKLLVSWFQNFLGILILDIL 127 Q F E N +VL YF VF L + F + GI+ LDIL Sbjct: 126 QRSLFSESISNYLVLQYKLRYFPVFDLKIYDFHSGTGIIALDIL 169
>ISK5_HUMAN (Q9NQ38) Serine protease inhibitor Kazal-type 5 precursor| (Lympho-epithelial Kazal-type-related inhibitor) (LEKTI) [Contains: Hemofiltrate peptide HF6478; Hemofiltrate peptide HF7665] Length = 1064 Score = 27.7 bits (60), Expect = 7.0 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +3 Query: 33 QIKKKQGVFSCTMT*QEKFRLVKGKIY-NLCGTKCPG*VSLENSETKKLTA*IR*SRSNT 209 Q + K G+ CT + R GK++ NLC + C EN E KK A R R + Sbjct: 301 QNQAKNGILFCTRE-NDPIRGPDGKMHGNLC-SMCQAYFQAENEEKKKAEARARNKRESG 358 Query: 210 ITTQY 224 T Y Sbjct: 359 KATSY 363
>ATP6_AEDAL (Q5JCK5) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 226 Score = 27.3 bits (59), Expect = 9.1 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = -3 Query: 192 TVFKLLVSWFQNFLGILIL 136 T+F + ++WF F+G+LI+ Sbjct: 14 TIFNMSLNWFSTFIGLLII 32 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,953,286 Number of Sequences: 219361 Number of extensions: 893312 Number of successful extensions: 1972 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1971 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)