| Clone Name | rbastl16g09 |
|---|---|
| Clone Library Name | barley_pub |
>BXB_CLOBO (P10844) Botulinum neurotoxin type B precursor (EC 3.4.24.69)| (BoNT/B) (Bontoxilysin B) [Contains: Botulinum neurotoxin B light chain; Botulinum neurotoxin B heavy chain] Length = 1290 Score = 31.2 bits (69), Expect = 0.67 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 225 LEPSYRGSNNRISLQCGKRIISS*KHHLALPRLQLCKCI 341 +E YRG N I+ Q + I K HLA+ ++Q+CK + Sbjct: 404 MEKEYRGQNKAINKQAYEEIS---KEHLAVYKIQMCKSV 439
>MATK_FROFL (Q5J309) Maturase K (Intron maturase)| Length = 505 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = -1 Query: 233 WF*SESIADRLT*SLNILLASLGLSCKMHT*EY*SLKIWQCFIS 102 WF E + LLAS G S MH +Y + WQC+ S Sbjct: 267 WFFKEPFPHYVRYQGKALLASKGTSLLMHKWKYYFIYFWQCYFS 310
>MATK_GOMPU (Q5J306) Maturase K (Intron maturase)| Length = 505 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 182 LLASLGLSCKMHT*EY*SLKIWQCFIS 102 LLAS G S MH +Y + WQC+ S Sbjct: 284 LLASKGTSLLMHKWKYYFISFWQCYFS 310
>MATK_GOMHA (Q5J308) Maturase K (Intron maturase)| Length = 505 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 182 LLASLGLSCKMHT*EY*SLKIWQCFIS 102 LLAS G S MH +Y + WQC+ S Sbjct: 284 LLASKGTSLLMHKWKYYFISFWQCYFS 310
>MATK_GRABR (Q95EE5) Maturase K (Intron maturase)| Length = 510 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 182 LLASLGLSCKMHT*EY*SLKIWQCFIS 102 +LAS G S MH +Y + WQC+ S Sbjct: 289 ILASKGTSLLMHKWKYYLINFWQCYFS 315
>JAK3_HUMAN (P52333) Tyrosine-protein kinase JAK3 (EC 2.7.10.2) (Janus kinase| 3) (JAK-3) (Leukocyte janus kinase) (L-JAK) Length = 1124 Score = 28.5 bits (62), Expect = 4.3 Identities = 21/66 (31%), Positives = 32/66 (48%) Frame = +3 Query: 138 LSSMHLARQTKASQQNVQALGKTISYRL*LEPSYRGSNNRISLQCGKRIISS*KHHLALP 317 L+ + LAR + Q L KT+SY+ L PS R +S +RI + + AL Sbjct: 165 LAVLDLARMAREQAQRPGELLKTVSYKACLPPSLRDLIQGLSFVTRRRIRRTVRR--ALR 222 Query: 318 RLQLCK 335 R+ C+ Sbjct: 223 RVAACQ 228
>MATK_MAMHA (Q95EC9) Maturase K (Intron maturase)| Length = 510 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 182 LLASLGLSCKMHT*EY*SLKIWQCFIS 102 +LAS G S MH +Y L WQC S Sbjct: 288 ILASKGTSLLMHKWKYYLLNFWQCHFS 314
>IL6RB_HUMAN (P40189) Interleukin-6 receptor beta chain precursor (IL-6R-beta)| (Interleukin 6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin M receptor) (CD130 antigen) (CDw130) Length = 918 Score = 27.3 bits (59), Expect = 9.6 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 5/63 (7%) Frame = +2 Query: 17 LSGNPRDKPQQLL-----RRHATLATIGSTQSNLR*SIAKSSSFSTLKYASCKTDQG*PA 181 +SG P +KP+ L + G +++L + S ++T K+A CK + P Sbjct: 121 ISGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPT 180 Query: 182 ECS 190 C+ Sbjct: 181 SCT 183 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,761,475 Number of Sequences: 219361 Number of extensions: 607781 Number of successful extensions: 1220 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1220 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)