| Clone Name | rbastl16e06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | URED_SYNY3 (P73047) Urease accessory protein ureD | 30 | 2.0 | 2 | SYK2_MYCTU (P94974) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6... | 28 | 4.5 | 3 | SYK2_MYCBO (Q7VEV7) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6... | 28 | 4.5 | 4 | Y1356_MYCBO (P64806) Hypothetical protein Mb1356 | 28 | 5.9 | 5 | Y1322_MYCTU (P64805) Hypothetical protein Rv1322/MT1363.1 | 28 | 5.9 |
|---|
>URED_SYNY3 (P73047) Urease accessory protein ureD| Length = 270 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 274 AASVDERRQWHAQSWFRYESFGHRAKLSRELI*KLSKKERLY 149 A++V+ W A W RY+ GHR ++ L+ K +R + Sbjct: 4 ASTVNPSAPWQANLWLRYDRPGHRTRMVECLVQAPLKVQRSF 45
>SYK2_MYCTU (P94974) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6)| (Lysine--tRNA ligase 2) (LysRS 2) Length = 1172 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 47 VLPLQRRNAVHKGHRP 94 VLP RRN VH GH P Sbjct: 628 VLPFSRRNRVHTGHHP 643
>SYK2_MYCBO (Q7VEV7) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6)| (Lysine--tRNA ligase 2) (LysRS 2) Length = 1172 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 47 VLPLQRRNAVHKGHRP 94 VLP RRN VH GH P Sbjct: 628 VLPFSRRNRVHTGHHP 643
>Y1356_MYCBO (P64806) Hypothetical protein Mb1356| Length = 98 Score = 28.1 bits (61), Expect = 5.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 283 ETPAASVDERRQWHAQSW 230 + P A VD+RR WH W Sbjct: 68 DLPQAGVDDRRHWHTPCW 85
>Y1322_MYCTU (P64805) Hypothetical protein Rv1322/MT1363.1| Length = 98 Score = 28.1 bits (61), Expect = 5.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 283 ETPAASVDERRQWHAQSW 230 + P A VD+RR WH W Sbjct: 68 DLPQAGVDDRRHWHTPCW 85 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,302,563 Number of Sequences: 219361 Number of extensions: 684273 Number of successful extensions: 1971 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1971 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)