| Clone Name | rbastl16e04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YLK2_CAEEL (P41950) Hypothetical protein D1044.2 precursor | 31 | 0.95 | 2 | MATN2_HUMAN (O00339) Matrilin-2 precursor | 29 | 3.6 | 3 | CASR_BOVIN (P35384) Extracellular calcium-sensing receptor precu... | 28 | 6.2 | 4 | CHFR_MOUSE (Q810L3) Ubiquitin-protein ligase CHFR (EC 6.3.2.-) (... | 28 | 8.1 | 5 | Y1030_TREPA (O83993) Hypothetical protein TP1030 | 28 | 8.1 | 6 | THCB_RHOER (P43492) Cytochrome P450 116 (EC 1.14.-.-) | 28 | 8.1 |
|---|
>YLK2_CAEEL (P41950) Hypothetical protein D1044.2 precursor| Length = 1090 Score = 30.8 bits (68), Expect = 0.95 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = +3 Query: 3 RVHTQAFSLF*PAEAEPSSFL-TSSSIPDA--SKESDVQVQQPA*TLHMEPSKPKRPN 167 + HT ++ P EA PS F+ T++ P A + + + VQQP+ ++ +P K + N Sbjct: 884 KAHTTTTTMMIPTEAPPSIFVFTTTQKPRAQSTTQKRIIVQQPSIVVNSQPPKQRNDN 941
>MATN2_HUMAN (O00339) Matrilin-2 precursor| Length = 956 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 40 QKQNHLRSSPPAPSPMQAKNQTCRCSNL 123 QK +H S+ P+ SP++ K+ C+C NL Sbjct: 896 QKLSH--STKPSGSPLEEKHDQCKCENL 921
>CASR_BOVIN (P35384) Extracellular calcium-sensing receptor precursor (CaSR)| (Parathyroid Cell calcium-sensing receptor) Length = 1085 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +2 Query: 62 PHLQLHPRCKQRIRRAGAATCMNSSHGTIQTQATKHNESDHYT 190 P Q PRCKQ++ + S Q A H S H T Sbjct: 961 PQSQQPPRCKQKVIFGSGTVTFSLSFDEPQKTAVAHRNSTHQT 1003
>CHFR_MOUSE (Q810L3) Ubiquitin-protein ligase CHFR (EC 6.3.2.-) (Checkpoint| with forkhead and RING finger domains protein) Length = 664 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 11/47 (23%) Frame = +1 Query: 103 TCRC-----------SNLHELFTWNHPNPSDQTQ*IRSLHARANVTR 210 TCRC +NL E + HP+ S + +RS+ AR +T+ Sbjct: 340 TCRCPVERICKNHILNNLVEAYLIQHPDKSRSEEDVRSMDARNKITQ 386
>Y1030_TREPA (O83993) Hypothetical protein TP1030| Length = 165 Score = 27.7 bits (60), Expect = 8.1 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +1 Query: 64 SPPAPSPMQAKNQTCRCSNL--HELFTWNHPNPSDQT 168 +P + +P A+ +T RCS+L H +FT P P T Sbjct: 62 NPGSSAPAPAQKKTARCSSLPTHFIFTTPPPPPVSST 98
>THCB_RHOER (P43492) Cytochrome P450 116 (EC 1.14.-.-)| Length = 436 Score = 27.7 bits (60), Expect = 8.1 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +1 Query: 100 QTCRCSNLHE-LFTWNHPNPSDQTQ 171 +TCR + + LFTW HP +QT+ Sbjct: 181 ETCRQYGMQQTLFTWGHPTGDEQTR 205 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,763,599 Number of Sequences: 219361 Number of extensions: 774868 Number of successful extensions: 2136 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2086 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2135 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)