| Clone Name | rbastl16d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SNF2_YEAST (P22082) Transcription regulatory protein SNF2 (EC 3.... | 31 | 0.98 | 2 | P3C2G_RAT (O70173) Phosphatidylinositol-4-phosphate 3-kinase C2 ... | 29 | 2.8 | 3 | TERL_LAMBD (P03708) Terminase large subunit (DNA packaging prote... | 28 | 6.3 | 4 | 6PGL_DROME (Q9VZ64) Putative 6-phosphogluconolactonase (EC 3.1.1... | 28 | 8.3 |
|---|
>SNF2_YEAST (P22082) Transcription regulatory protein SNF2 (EC 3.6.1.-)| (ATP-dependent helicase SNF2) (SWI/SNF complex component SNF2) (Regulatory protein SWI2) (Regulatory protein GAM1) (Transcription factor TYE3) Length = 1703 Score = 30.8 bits (68), Expect = 0.98 Identities = 19/74 (25%), Positives = 29/74 (39%), Gaps = 11/74 (14%) Frame = +3 Query: 27 KKRNAITTLHNSGDAPNLHKTHDEDTAPPSKNQPIVVTYMYRPQKSAI-----------I 173 KK T + + APN +KTH E PP +P+ + + K I + Sbjct: 391 KKEENETISNVAKTAPNSNKTHTEQNNPPKPQKPVPLNVLQDQYKEGIKVVDIDDPDMMV 450 Query: 174 TRLKTYNTTHQNMD 215 N +H N+D Sbjct: 451 DSFTMPNISHSNID 464
>P3C2G_RAT (O70173) Phosphatidylinositol-4-phosphate 3-kinase C2| domain-containing gamma polypeptide (EC 2.7.1.154) (Phosphoinositide 3-Kinase-C2-gamma) (PtdIns-3-kinase C2 gamma) (PI3K-C2gamma) Length = 1505 Score = 29.3 bits (64), Expect = 2.8 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 3/66 (4%) Frame = +3 Query: 6 LASLASWKKRNAITTLH--NSGDAPN-LHKTHDEDTAPPSKNQPIVVTYMYRPQKSAIIT 176 L S ++K ++ LH S D P L + D+D + NQ + T++++ + + T Sbjct: 348 LGSHKIFQKSKSVIQLHLQRSRDTPGKLSRKRDDDRSRVHLNQLLEFTHIWKISRQCLST 407 Query: 177 RLKTYN 194 +K+YN Sbjct: 408 VMKSYN 413
>TERL_LAMBD (P03708) Terminase large subunit (DNA packaging protein A) (GpA)| Length = 641 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 27 KKRNAITTLHNSGDAPNLHKTHDEDT 104 K+RN + L GDA N KTH E T Sbjct: 97 KQRNTLIWLPTDGDAENFMKTHVEPT 122
>6PGL_DROME (Q9VZ64) Putative 6-phosphogluconolactonase (EC 3.1.1.31) (6PGL)| Length = 243 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 40 PLQPCTTQVTRQIYIKLMTRTQLPPQRINLLL 135 P QP T Q T+++ I + + PP+RI L Sbjct: 151 PEQPATLQETKRLVIPIRNSPKPPPERITFTL 182 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,256,020 Number of Sequences: 219361 Number of extensions: 629061 Number of successful extensions: 1486 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1486 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)