| Clone Name | rbastl15g06 |
|---|---|
| Clone Library Name | barley_pub |
>ATG26_CRYNE (Q5KK25) Sterol 3-beta-glucosyltransferase (EC 2.4.1.173)| (Autophagy-related protein 26) Length = 1585 Score = 30.4 bits (67), Expect = 1.3 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +2 Query: 26 ITRLHLDSFRWHTFLQGHTNHLPCVPTGINGTAHRQLEQPRTPPLASYAPTPTCPPLP-T 202 +T D W + G N G++ T ++EQ + P L +++PT PPL T Sbjct: 1188 MTYTMFDQVFWRA-ISGQVNRWRRNVLGLDATTFDKMEQHKVPFLYNFSPTVVPPPLDWT 1246 Query: 203 DW 208 +W Sbjct: 1247 EW 1248
>BCL9_HUMAN (O00512) B-cell lymphoma 9 protein (Bcl-9) (Legless homolog)| Length = 1426 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +2 Query: 92 PCVPTGINGTAHRQLEQPRTPPLASYAPTPTCPPLPTD 205 P VP + + + TPP+ + AP P PP P D Sbjct: 238 PPVPANQDQNSSQNTRLQPTPPIPAPAPKPAAPPRPLD 275
>MLL3_HUMAN (Q8NEZ4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) (Homologous to ALR protein) Length = 4911 Score = 29.6 bits (65), Expect = 2.3 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%) Frame = +2 Query: 62 TFLQGHTN--HLPCVP--TGINGTAHRQLEQPRTPPLASYAPTPTCPPLP 199 T + GHT+ +P +P + AH L PR P + P TC P P Sbjct: 3318 TVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAP 3367
>CDKL5_HUMAN (O76039) Cyclin-dependent kinase-like 5 (EC 2.7.11.22)| (Serine/threonine-protein kinase 9) Length = 1030 Score = 29.3 bits (64), Expect = 2.9 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 86 HLPCVPTGINGTAHRQLEQPRTPPLASYAPTPTCPPL 196 H PCVP N HR + P P+ T CP L Sbjct: 945 HTPCVP---NRALHRPISSPAPYPVLQVRGTSMCPTL 978
>PROML_DROME (P82295) Prominin-like protein| Length = 1013 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 5/35 (14%) Frame = +2 Query: 113 NGTAHRQLEQPRTPPL--ASYAPTPT---CPPLPT 202 +GT H QL QP PP+ Y PT PP PT Sbjct: 74 HGTTHEQLGQPHWPPVQYTVYRPTTNYTKAPPPPT 108
>E75BB_DROME (P13055) Ecdysone-induced protein 75B isoform B (E75-C)| Length = 1412 Score = 28.9 bits (63), Expect = 3.8 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Frame = +2 Query: 68 LQGHTNHLPCVPT-----GINGTAHRQLEQPRTPPLASYAPTPTCPPLP 199 L H+ P P G +Q +Q +TPPLA P P PP P Sbjct: 232 LHHHSRSAPVSPVIARRGGAAAYMDQQYQQRQTPPLAPPPPPPPPPPPP 280
>SIR4_YEAST (P11978) Regulatory protein SIR4 (Silent information regulator 4)| Length = 1358 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +2 Query: 77 HTNHLPCVPTGINGTAHRQLEQPRTPPL 160 HT+ P P+ + T+H+QL+QP++ PL Sbjct: 61 HTS--PHQPSDVKPTSHKQLQQPKSSPL 86
>BC11B_HUMAN (Q9C0K0) B-cell lymphoma/leukemia 11B (B-cell CLL/lymphoma 11B)| (Radiation-induced tumor suppressor gene 1 protein) (hRit1) (COUP-TF-interacting protein 2) Length = 894 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +2 Query: 68 LQGHTNHLPCVPTGINGTAHRQLEQPRTPPLASYAPTPTCPPLP 199 L G+++ P V G HR L + P + + TP PP+P Sbjct: 370 LAGNSSTPPPVSPGRGNPMHRLLNPFQPSPKSPFLSTPPLPPMP 413
>RCOR2_XENLA (Q6NRZ0) REST corepressor 2| Length = 503 Score = 28.5 bits (62), Expect = 5.0 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 10/45 (22%) Frame = +2 Query: 89 LPCVPTGINGTAHRQ--------LEQPRTPPLASYAP--TPTCPP 193 +PC PT HRQ L QPR PPL AP +P PP Sbjct: 452 IPCAPT-----LHRQPPPLQPGRLLQPRPPPLVRPAPRQSPRAPP 491
>BC11B_MOUSE (Q99PV8) B-cell lymphoma/leukemia 11B (B-cell CLL/lymphoma 11B)| (Radiation-induced tumor suppressor gene 1 protein) (mRit1) (COUP-TF-interacting protein 2) Length = 884 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +2 Query: 68 LQGHTNHLPCVPTGINGTAHRQLEQPRTPPLASYAPTPTCPPLP 199 L G+++ P V G HR L + P + + TP PP+P Sbjct: 370 LAGNSSTPPPVSPGRGNPMHRLLNPFQPSPKSPFLSTPPLPPMP 413
>RBM12_MOUSE (Q8R4X3) RNA-binding protein 12 (RNA-binding motif protein 12)| (SH3/WW domain anchor protein in the nucleus) (SWAN) Length = 1002 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 143 PRTPPLASYAPTPTCPPLPT 202 P PPL S P P PP+PT Sbjct: 197 PSLPPLPSIPPIPVPPPVPT 216
>PER1_MOUSE (O35973) Period circadian protein 1 (Circadian pacemaker protein| Rigui) (mPER) (M-Rigui) Length = 1291 Score = 28.1 bits (61), Expect = 6.5 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 92 PCVPTGINGTAHRQLEQPRTPPLASYAPTPTCPPLP 199 P P+ G + +E P TP AS++P+P+ PP P Sbjct: 928 PTPPSYPYGVSQAPVEGPPTP--ASHSPSPSLPPPP 961
>GAG_HTL1C (P14076) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 429 Score = 27.7 bits (60), Expect = 8.6 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 92 PCVPTGINGTAHRQLEQPRTPPLASYAPTPTCPPLPTDW 208 PC G G R QPR PP P P C PT W Sbjct: 356 PCFRCGKAGHWSRDCTQPRPPP----GPCPLCQD-PTHW 389
>GAG_HTL1A (P03345) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 429 Score = 27.7 bits (60), Expect = 8.6 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 92 PCVPTGINGTAHRQLEQPRTPPLASYAPTPTCPPLPTDW 208 PC G G R QPR PP P P C PT W Sbjct: 356 PCFRCGKAGHWSRDCTQPRPPP----GPCPLCQD-PTHW 389
>M3K11_HUMAN (Q16584) Mitogen-activated protein kinase kinase kinase 11 (EC| 2.7.11.25) (Mixed lineage kinase 3) (Src-homology 3 domain-containing proline-rich kinase) Length = 847 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 116 GTAHRQLEQPRTPPLASYAPTPTCPP 193 G + E P TPP + AP PT PP Sbjct: 666 GPGRERGESPTTPPTPTPAPCPTEPP 691
>GAG_HTL1M (P14077) Gag polyprotein [Contains: Major core protein p19; Major| core protein p24; Nucleic acid-binding protein p15] Length = 428 Score = 27.7 bits (60), Expect = 8.6 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 92 PCVPTGINGTAHRQLEQPRTPPLASYAPTPTCPPLPTDW 208 PC G G R QPR PP P P C PT W Sbjct: 355 PCFRCGKAGHWSRDCTQPRPPP----GPCPLCQD-PTHW 388
>DIAP3_HUMAN (Q9NSV4) Protein diaphanous homolog 3 (Diaphanous-related formin-3)| (DRF3) Length = 1110 Score = 27.7 bits (60), Expect = 8.6 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 Query: 86 HLPCVPTGINGTAHRQLEQPRTPPLASYAPTPTCPPLP 199 ++P P+ GT H L P PPL S P PP P Sbjct: 559 NIPLPPSKEGGTGHSALPPP--PPLPSGGGVPPPPPPP 594
>BAT2_MOUSE (Q7TSC1) Large proline-rich protein BAT2 (HLA-B-associated| transcript 2) Length = 2158 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 92 PCVPTGINGTAHRQLEQPRTPPLASYAPTPTCPPLPT 202 P +P T ++ E+P P AP+P P+PT Sbjct: 530 PALPPTPTPTPEKEPEEPAQAPPVQAAPSPGVAPVPT 566 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,139,107 Number of Sequences: 219361 Number of extensions: 553350 Number of successful extensions: 2588 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 2044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2546 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)