| Clone Name | rbastl15f09 |
|---|---|
| Clone Library Name | barley_pub |
>NPD_BORPE (Q7VX46) NAD-dependent deacetylase (EC 3.5.1.-) (Regulatory protein| SIR2 homolog) Length = 274 Score = 31.2 bits (69), Expect = 0.68 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 266 PRGPGQ*TLEISGRQWSSCGNGVAP 192 PRGP Q TLE++ QW++ G AP Sbjct: 138 PRGPWQHTLELANPQWAALQAGAAP 162
>NPD_BORBR (Q7WLE5) NAD-dependent deacetylase (EC 3.5.1.-) (Regulatory protein| SIR2 homolog) Length = 274 Score = 31.2 bits (69), Expect = 0.68 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 266 PRGPGQ*TLEISGRQWSSCGNGVAP 192 PRGP Q TLE++ QW++ G AP Sbjct: 138 PRGPWQHTLELANPQWAALQAGAAP 162
>CP1A1_CAVPO (Q06367) Cytochrome P450 1A1 (EC 1.14.14.1) (CYPIA1)| Length = 516 Score = 30.8 bits (68), Expect = 0.89 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 4/39 (10%) Frame = -1 Query: 155 GFYASMSCCIHVAKW----DQRLSGSKIV*SGELFGSPE 51 GFY CCI V +W DQ+L G V E F SP+ Sbjct: 394 GFYIPKGCCIFVNQWQINHDQKLWGDPSVFRPERFLSPD 432
>VMSA_HBVYW (P03138) Major surface antigen precursor| Length = 388 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 267 SKGSWT-VDLGDFWASMEFLWEWSSATYLYLFLV 169 S G+ T + + WA +FLWEW+SA + +L L+ Sbjct: 305 SDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLL 338
>VMSA_HBVIA (P24025) Major surface antigen precursor| Length = 388 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 267 SKGSWT-VDLGDFWASMEFLWEWSSATYLYLFLV 169 S G+ T + + WA +FLWEW+SA + +L L+ Sbjct: 305 SDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLL 338
>VMSA_HBVAY (P03139) Major surface antigen precursor| Length = 388 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 267 SKGSWT-VDLGDFWASMEFLWEWSSATYLYLFLV 169 S G+ T + + WA +FLWEW+SA + +L L+ Sbjct: 305 SDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLL 338
>ATP4B_RABIT (P18597) Potassium-transporting ATPase beta chain (Proton pump beta| chain) (Gastric H+/K+ ATPase beta subunit) Length = 291 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -3 Query: 255 WTVDLGDFWASMEFLWEWSSATYLYLFLVHLPCWLLCIHVLL 130 W D G W W S Y+ ++V + LCI+VL+ Sbjct: 22 WNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCIYVLM 63
>VMSA_HBVIL (P12911) Major surface antigen precursor| Length = 388 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 267 SKGSWT-VDLGDFWASMEFLWEWSSATYLYLFLV 169 S G+ T + + WA +FLWEW+S + +L L+ Sbjct: 305 SDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLL 338
>ATP4B_RAT (P18598) Potassium-transporting ATPase beta chain (Proton pump beta| chain) (Gastric H+/K+ ATPase beta subunit) Length = 294 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -3 Query: 255 WTVDLGDFWASMEFLWEWSSATYLYLFLVHLPCWLLCIHVLL 130 W D G W W S Y ++V + LCI+VL+ Sbjct: 22 WNPDTGQMLGRTPARWVWISLYYAAFYVVMTGLFALCIYVLM 63
>VMSA_HBVDN (P30019) Major surface antigen| Length = 226 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 267 SKGSWT-VDLGDFWASMEFLWEWSSATYLYLFLV 169 S G+ T + + WA FLWEW+S + +L L+ Sbjct: 143 SDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLL 176
>VMSA_HBVAD (P31868) Major surface antigen| Length = 226 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 267 SKGSWT-VDLGDFWASMEFLWEWSSATYLYLFLV 169 S G+ T + + WA FLWEW+S + +L L+ Sbjct: 143 SDGNCTCIPIPSSWAFANFLWEWASVRFSWLSLL 176
>ATP4B_PIG (P18434) Potassium-transporting ATPase beta chain (Proton pump beta| chain) (Gastric H+/K+ ATPase beta subunit) (gp60-90) Length = 290 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -3 Query: 255 WTVDLGDFWASMEFLWEWSSATYLYLFLVHLPCWLLCIHVLL 130 W D G W W S Y+ ++V + LCI+VL+ Sbjct: 22 WNPDTGQMLGRTLSRWVWISLYYVAFYVVMSGIFALCIYVLM 63
>CI005_HUMAN (Q9H330) Protein C9orf5 (Protein CG-2)| Length = 911 Score = 29.3 bits (64), Expect = 2.6 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 4/67 (5%) Frame = -3 Query: 294 AALLIIKGLSKGS----WTVDLGDFWASMEFLWEWSSATYLYLFLVHLPCWLLCIHVLLH 127 AA LI +GL S WT+ +G + ++ F +W+++T YL V +P W++ +L H Sbjct: 178 AATLICRGLDYFSSLWIWTLVVG-YVLTVSF--KWNASTERYLRAVSIPVWII---LLFH 231 Query: 126 PCREVGS 106 GS Sbjct: 232 LASLAGS 238
>ATP4B_MOUSE (P50992) Potassium-transporting ATPase beta chain (Proton pump beta| chain) (Gastric H+/K+ ATPase beta subunit) Length = 294 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -3 Query: 255 WTVDLGDFWASMEFLWEWSSATYLYLFLVHLPCWLLCIHVLL 130 W D G W W S Y ++V + LCI+VL+ Sbjct: 22 WNPDTGQMLGRTPARWVWISLYYAGFYVVMTGLFALCIYVLM 63
>VMSA_HBVDR (P03140) Major surface antigen precursor| Length = 399 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 267 SKGSWT-VDLGDFWASMEFLWEWSSATYLYLFLV 169 S G+ T + + WA FLWEW+S + +L L+ Sbjct: 316 SDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLL 349
>VMSA_HBVA4 (Q05496) Major surface antigen precursor| Length = 399 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 267 SKGSWT-VDLGDFWASMEFLWEWSSATYLYLFLV 169 S G+ T + + WA ++LWEW+SA + +L L+ Sbjct: 316 SDGNCTCIPIPSSWALGKYLWEWASARFSWLSLL 349
>VMSA_HBVAR (P31869) Major surface antigen| Length = 226 Score = 28.9 bits (63), Expect = 3.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYLFLV 169 WA FLWEW+S + +L L+ Sbjct: 156 WAFARFLWEWASVRFSWLSLL 176
>TBC10_HUMAN (Q9BXI6) TBC1 domain family member 10A (EBP50-PDX interactor of 64| kDa) (EPI64 protein) Length = 508 Score = 28.9 bits (63), Expect = 3.4 Identities = 22/68 (32%), Positives = 28/68 (41%), Gaps = 10/68 (14%) Frame = +2 Query: 146 HKSQQGRWTRNR----YRYVALLHSHKNSIDAQKSPRSTVQD------PLDSPFIINNAA 295 H Q RW R R LH K +DA+ PR +Q PLD+P + A Sbjct: 365 HLIQLRRWQETRGELQCRSPPRLHGAKAILDAEPGPRPALQPSPSIRLPLDAPLPGSKAK 424 Query: 296 GGKPKMAR 319 PK A+ Sbjct: 425 PKPPKQAQ 432
>PYRG_VIBVY (Q7MHQ0) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 545 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 123 MDAARHGCIKASREDGQETDTDTWRYSIPTRTPLTPRN 236 M +HG + + EDG ETD D Y RT +T RN Sbjct: 52 MSPTQHGEVFVT-EDGAETDLDLGHYERFIRTKMTKRN 88
>PYRG_VIBVU (Q8DC63) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 545 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 123 MDAARHGCIKASREDGQETDTDTWRYSIPTRTPLTPRN 236 M +HG + + EDG ETD D Y RT +T RN Sbjct: 52 MSPTQHGEVFVT-EDGAETDLDLGHYERFIRTKMTKRN 88
>ATP4B_HUMAN (P51164) Potassium-transporting ATPase beta chain (Proton pump beta| chain) (Gastric H+/K+ ATPase beta subunit) Length = 291 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -3 Query: 255 WTVDLGDFWASMEFLWEWSSATYLYLFLVHLPCWLLCIHVLL 130 W D G W W S Y+ ++V + LC++VL+ Sbjct: 22 WNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLM 63
>PYRG_VIBPA (Q87LP9) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 546 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 123 MDAARHGCIKASREDGQETDTDTWRYSIPTRTPLTPRN 236 M +HG + + EDG ETD D Y RT +T RN Sbjct: 52 MSPTQHGEVFVT-EDGAETDLDLGHYERFIRTKMTKRN 88
>KUP_ERWCT (Q6DB92) Low affinity potassium transport system protein kup (Kup| system potassium uptake protein) Length = 622 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 5/34 (14%) Frame = +2 Query: 167 WTRNRYRYVALLHSHKNSIDA-----QKSPRSTV 253 W R+R + LH H NS+DA +KSP + V Sbjct: 440 WKSERFRLLRRLHEHGNSLDAMIASLEKSPPTRV 473
>PYRG_VIBCH (Q9KPC4) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 123 MDAARHGCIKASREDGQETDTDTWRYSIPTRTPLTPRN 236 M +HG + + EDG ETD D Y RT +T RN Sbjct: 51 MSPTQHGEVFVT-EDGAETDLDLGHYERFIRTKMTKRN 87
>VLLY_VIBVU (O06695) Hemolysin vllY| Length = 357 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 44 YTVLDYQTIRQIKQSYSRLTFDPTSRHGCSKTWMHK 151 YT D I Q+K +S L F ++H + W+++ Sbjct: 18 YTAADNTGIEQLKHLFSSLGFAEVAKHRSKEAWLYR 53
>PYRG_YERPE (Q8ZBN1) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 544 Score = 28.5 bits (62), Expect = 4.4 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 Query: 123 MDAARHGCIKASREDGQETDTDTWRYSIPTRTPLTPRN 236 M +HG + + EDG ETD D Y RT +T RN Sbjct: 51 MSPTQHGEVFVT-EDGAETDLDLGHYERFIRTKMTRRN 87
>ALMS1_HUMAN (Q8TCU4) Alstrom syndrome protein 1| Length = 4167 Score = 28.1 bits (61), Expect = 5.8 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +2 Query: 92 SRLTFDPTSRHGCSKTWMHKSQQGRWTRNRYRYVALLHSHKNSIDAQKS 238 S T D + K W + QQ + + R+ +L SHKN+ + +KS Sbjct: 3646 SESTHDDSRGERSVKEWSGRQQQRNKLQKKKRFKSLEKSHKNTGELKKS 3694
>VMSA_HPBGS (P03144) Major surface antigen precursor| Length = 428 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 10/43 (23%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYLFL----------VHLPCWLLCIHVL 133 WA +LWEW+ A + +L L + L WLL I ++ Sbjct: 358 WALGSYLWEWALARFSWLSLLVPLLQWLGGISLTVWLLLIWMI 400
>VMSA_HBVWO (P17399) Major surface antigen precursor| Length = 388 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYLFLV 169 WA ++LWEW+S + +L L+ Sbjct: 318 WAFAKYLWEWASVRFSWLSLL 338
>VMSA_HBVWJ (P17398) Major surface antigen precursor| Length = 388 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYLFLV 169 WA ++LWEW+S + +L L+ Sbjct: 318 WAFAKYLWEWASVRFSWLSLL 338
>VMSA_HBVWI (P17397) Major surface antigen precursor| Length = 388 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYLFLV 169 WA ++LWEW+S + +L L+ Sbjct: 318 WAFAKYLWEWASVRFSWLSLL 338
>VMSA_HBVAW (P03142) Major surface antigen precursor| Length = 388 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYLFLV 169 WA ++LWEW+S + +L L+ Sbjct: 318 WAFAKYLWEWASVRFSWLSLL 338
>ATP4B_CANFA (P33704) Potassium-transporting ATPase beta chain (Proton pump beta| chain) (Gastric H+/K+ ATPase beta subunit) Length = 290 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = -3 Query: 255 WTVDLGDFWASMEFLWEWSSATYLYLFLVHLPCWLLCIHVLL 130 W D G W W S Y+ ++V + LCI+ L+ Sbjct: 22 WNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGIFALCIYTLM 63
>VMSA_HBVWP (Q02317) Major surface antigen precursor| Length = 399 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYLFLV 169 WA ++LWEW+S + +L L+ Sbjct: 329 WAFAKYLWEWASVRFSWLSLL 349
>VMSA_HBVW9 (P17101) Major surface antigen precursor| Length = 399 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYLFLV 169 WA ++LWEW+S + +L L+ Sbjct: 329 WAFAKYLWEWASVRFSWLSLL 349
>VMSA_HBVW2 (P03141) Major surface antigen precursor| Length = 399 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYLFLV 169 WA ++LWEW+S + +L L+ Sbjct: 329 WAFAKYLWEWASVRFSWLSLL 349
>DTX1_XENLA (Q8AW93) Protein deltex-1 (xDtx1)| Length = 623 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Frame = +2 Query: 50 VLDYQTIRQIKQSYSRLT------FDPTSRHGCSKTWMHKSQQGRWT 172 V+D QT+ Q +Q + F+P+S G W ++ G WT Sbjct: 72 VIDLQTMHQYRQDTGTIRPVRRNFFEPSSAPGKGIVWEWENDAGSWT 118
>PYRG_HAEIN (P44341) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 545 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 123 MDAARHGCIKASREDGQETDTDTWRYSIPTRTPLTPRN 236 M +HG + + +DG ETD D Y RT +T RN Sbjct: 52 MSPTQHGEVFVT-QDGAETDLDLGHYERFIRTKMTKRN 88
>VMSA_WHVW6 (P11293) Major surface antigen precursor| Length = 282 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYL-FLVHLPCWL 151 WA +LWEW+ A + +L LV L WL Sbjct: 212 WALGNYLWEWALARFSWLNLLVPLLQWL 239
>VMSA_HBV (P31873) Major surface antigen| Length = 226 Score = 27.7 bits (60), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYLFLV 169 WA ++LWEW S + +L L+ Sbjct: 156 WAFAKYLWEWGSVRFSWLSLL 176
>VMSA_WHV8 (P17400) Major surface antigen precursor| Length = 431 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYL-FLVHLPCWL 151 WA +LWEW+ A + +L LV L WL Sbjct: 361 WALGNYLWEWALARFSWLNLLVPLLQWL 388
>VMSA_WHV7 (P12909) Major surface antigen precursor| Length = 431 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYL-FLVHLPCWL 151 WA +LWEW+ A + +L LV L WL Sbjct: 361 WALGNYLWEWALARFSWLNLLVPLLQWL 388
>VMSA_WHV59 (P12910) Major surface antigen precursor| Length = 431 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYL-FLVHLPCWL 151 WA +LWEW+ A + +L LV L WL Sbjct: 361 WALGNYLWEWALARFSWLNLLVPLLQWL 388
>SPTA3_HUMAN (Q8NHX4) Spermatogenesis-associated protein 3 (Testis spermatocyte| apoptosis-related protein 1) (Testis and spermatogenesis cell-related protein 1) Length = 183 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 143 MHKSQQGRWTRNRYRYVALLHSHKNSIDAQKSPRSTVQDP 262 M K ++ R R+R H+ NS Q SP ST Q P Sbjct: 1 MKKVKKKRSEARRHRDSTSQHASSNSTSQQPSPESTPQQP 40
>VMSA_WHV1 (P03143) Major surface antigen precursor| Length = 426 Score = 27.7 bits (60), Expect = 7.5 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 231 WASMEFLWEWSSATYLYL-FLVHLPCWL 151 WA +LWEW+ A + +L LV L WL Sbjct: 356 WALGNYLWEWALARFSWLNLLVPLLQWL 383
>STP2_PONPY (Q9N1A4) Nuclear transition protein 2 (TP-2) (TP2) (Fragment)| Length = 138 Score = 27.7 bits (60), Expect = 7.5 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 149 KSQQGRWTRNRYRYVALLHSHKNSIDAQKSPRSTVQDPLDSP 274 +SQ+G W++N + A SH N A S Q P DSP Sbjct: 44 QSQRGSWSQNSSQSPA---SHHNPTGAHSSSGHQSQSPNDSP 82
>PYRG_PASMU (Q9CJW9) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 542 Score = 27.7 bits (60), Expect = 7.5 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 123 MDAARHGCIKASREDGQETDTDTWRYSIPTRTPLTPRN 236 M +HG + + +DG ETD D Y RT +T RN Sbjct: 52 MSPTQHGEVFVT-QDGAETDLDLGHYERFIRTKMTKRN 88
>PSRA_WOLSU (P31075) Polysulfide reductase chain A precursor (Sulfur reductase| chain A) Length = 763 Score = 27.3 bits (59), Expect = 9.8 Identities = 19/71 (26%), Positives = 30/71 (42%) Frame = +2 Query: 74 QIKQSYSRLTFDPTSRHGCSKTWMHKSQQGRWTRNRYRYVALLHSHKNSIDAQKSPRSTV 253 +IKQ + T T+R G +KTW H Q + N + + + N S Sbjct: 135 EIKQKHGAHTVAFTARSGWNKTWFHHLAQAYGSPNIFGHESTCPLAYNMAGRDVFGGSMN 194 Query: 254 QDPLDSPFIIN 286 +D + +IIN Sbjct: 195 RDFAKAKYIIN 205
>ZN364_MOUSE (Q9D0C1) Zinc finger protein 364 (Rabring 7)| Length = 305 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 156 SREDGQETDTDTWRYSIPTRTPLTPR 233 + E G +T TD W S P R P+T R Sbjct: 102 ANERGHQTHTDFWGPSRPPRLPMTRR 127
>Y096_NPVOP (Q83951) Hypothetical 19.4 kDa protein (ORF97) (ORF 96)| Length = 172 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 31 LTPLLHCSGLPNNSPDQTILL 93 LT + H GL NNSPD T++L Sbjct: 124 LTLIEHFVGLKNNSPDHTLVL 144 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,438,652 Number of Sequences: 219361 Number of extensions: 1113055 Number of successful extensions: 3108 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 3053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3106 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)