| Clone Name | rbastl15f02 |
|---|---|
| Clone Library Name | barley_pub |
>WFDC2_RABIT (Q28631) WAP four-disulfide core domain protein 2 precursor (Major| epididymis-specific protein E4) (Epididymal protein BE-20) Length = 123 Score = 30.8 bits (68), Expect = 0.86 Identities = 22/57 (38%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = -1 Query: 202 SLPMNCCEDLLV*PLCAV*TLLCCDRGGSAACGCCNRLSCSVPTI---QLL*VEDLC 41 S +NC +D CA L CC G SA C N S P+I QL +DLC Sbjct: 41 SADLNCTQDCRADQDCAE-NLKCCRAGCSAICSIPNEKEGSCPSIDFPQLGICQDLC 96
>FOXJ3_MOUSE (Q8BUR3) Forkhead box protein J3| Length = 623 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 81 EQLSRLQQPHAADPPRSQHNKVHTAHRGHT 170 +Q S+LQ PH+ PP QH + H H+ T Sbjct: 406 QQHSQLQPPHSQHPPPHQHIQHHPNHQHQT 435
>UBIB_PSESM (Q87UZ0) Probable ubiquinone biosynthesis protein ubiB| Length = 539 Score = 29.6 bits (65), Expect = 1.9 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 Query: 87 LSRLQQPHAADPPRSQHNK 143 L R+ +PHA+DPPR H++ Sbjct: 468 LERMSRPHASDPPRPWHDR 486
>UN13B_HUMAN (O14795) Unc-13 homolog B (Munc13-2) (munc13)| Length = 1591 Score = 29.3 bits (64), Expect = 2.5 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +3 Query: 75 GTEQLSRLQQPHAADPPRSQHNKVHTAHRGHT 170 G+ QLS L Q H D + + +H+ H H+ Sbjct: 270 GSSQLSELDQYHEQDDDHRETDSIHSCHSSHS 301
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 28.9 bits (63), Expect = 3.3 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 10/57 (17%) Frame = -1 Query: 214 SVSRSLPMNCCEDLLV*PLCAV*TLL---CCDRG-GSAACG------CCNRLSCSVP 74 S S +CC+ P C+ + CC G GS+ C CC++ SC VP Sbjct: 124 SCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPCCSQSSCCVP 180
>ZDH13_MACFA (Q4R690) Probable palmitoyltransferase ZDHHC13 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 13) (DHHC-13) Length = 622 Score = 28.9 bits (63), Expect = 3.3 Identities = 21/94 (22%), Positives = 38/94 (40%), Gaps = 4/94 (4%) Frame = -2 Query: 312 WTSSPGRRRTSEDRELSNTYLSISIYICLNNETVCPVVCL*TAVKTCWCDLCVRCELYYV 133 W + PG + SE+ + N ++++ CL+ T C + +++ C +C C Y Sbjct: 395 WATDPGFTKASEEEKKVNI-ITLAETGCLDFRTFCTSCLIRKPLRSLHCHVCNSCVARYD 453 Query: 132 VTVVGQLRVVA----AIGLVALFLLFNYCEWKTY 43 + R + + LF L C W Y Sbjct: 454 QHCLWTGRCIGFGNHHYYIFFLFFLSMVCGWIIY 487
>KR171_HUMAN (Q9BYP8) Keratin-associated protein 17-1 (Keratin associated| protein 16.1) Length = 105 Score = 28.9 bits (63), Expect = 3.3 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = -1 Query: 190 NCCEDLLV*PLCAV*TLLCCDRGGS----AACG--CCNRLSC 83 NCCE+ P C CC GGS + CG CC C Sbjct: 17 NCCEECCCQPGCCGCCGSCCGCGGSGCGGSGCGGSCCGSSCC 58
>MT_PARLI (P80367) Metallothionein (MT)| Length = 65 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = -1 Query: 187 CCEDLLV*PL----CAV*TLLCCDRGGSAACGCCNRLSC 83 CC+D P C + T CC G S CG C+ +C Sbjct: 7 CCQDGKQCPCAGQECCI-TGKCCKDGASVCCGTCSNAAC 44
>HRP1_YEAST (Q99383) Nuclear polyadenylated RNA-binding protein 4 (Cleavage| factor IB) (CFIB) Length = 534 Score = 28.5 bits (62), Expect = 4.3 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 7/59 (11%) Frame = +3 Query: 81 EQLSRLQQPHAADPPRSQ--HNKVHTAHRGHTNKSSQQFIGKL-----RDTLSRYLGIY 236 + +S+ QQP + PP+ Q K + + +S + FIG L D L Y G Y Sbjct: 124 QTMSQFQQPSSQSPPQQQVTQTKEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKY 182
>KR109_HUMAN (P60411) Keratin-associated protein 10-9 (Keratin-associated| protein 10.9) (High sulfur keratin-associated protein 10.9) (Keratin-associated protein 18-9) (Keratin-associated protein 18.9) Length = 292 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -1 Query: 187 CCEDLLV*PLCAV*TLLCCDRGGSAACGCCNRLSC 83 CC+ + P+C+ + LCC + G CC C Sbjct: 192 CCKPICCVPVCSGASSLCCQQSGCQP-ACCTTSCC 225
>KRUC_SHEEP (P26372) Keratin, ultra high-sulfur matrix protein (UHS keratin)| Length = 182 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -1 Query: 199 LPMNCCEDLLV*PLCAV*TLLCCDRGGSAACGCCNRLSCSVP 74 +P+ CC P C+ + C +GG +CG C++ SC VP Sbjct: 143 VPVCCCV-----PACSCSS---CGKGGCGSCG-CSQSSCCVP 175
>SIN1_SCHPO (Q9P7Y9) Stress-activated map kinase-interacting protein 1| (SAPK-interacting protein 1) Length = 665 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 8/51 (15%) Frame = +3 Query: 90 SRLQQPHAADPPRSQH--------NKVHTAHRGHTNKSSQQFIGKLRDTLS 218 +++++ AA P +S+H NK H H T+ SQ+ ++DTL+ Sbjct: 386 AQIKENQAAYPFKSKHPTSIPEANNKTHIRHTSSTSSQSQKQAQDVKDTLN 436
>KRA57_HUMAN (Q6L8G8) Keratin-associated protein 5-7 (Keratin-associated protein| 5.7) (Ultrahigh sulfur keratin-associated protein 5.7) (Keratin-associated protein 5-3) (Keratin-associated protein 5.3) Length = 165 Score = 27.7 bits (60), Expect = 7.3 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 10/49 (20%) Frame = -1 Query: 190 NCCEDLLV*PLCAV*TLL---CCDRG-GSAACG------CCNRLSCSVP 74 +CC+ P C + CC G GS+ C CC++ SC VP Sbjct: 110 SCCQSSCCKPCCCQSSCCKPCCCSSGCGSSCCQSSCCNPCCSQSSCCVP 158
>FBW1A_HUMAN (Q9Y297) F-box/WD-repeat protein 1A (F-box and WD-repeats protein| beta-TrCP) (E3RSIkappaB) (pIkappaBalpha-E3 receptor subunit) Length = 605 Score = 27.3 bits (59), Expect = 9.5 Identities = 19/45 (42%), Positives = 23/45 (51%) Frame = -2 Query: 300 PGRRRTSEDRELSNTYLSISIYICLNNETVCPVVCL*TAVKTCWC 166 P R+ E L TY S + +CLN ETVC TA+KT C Sbjct: 65 PPRKIIPEKNSLRQTYNSCA-RLCLNQETVCLAS---TAMKTENC 105
>KR108_HUMAN (P60410) Keratin-associated protein 10-8 (Keratin-associated| protein 10.8) (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8) Length = 259 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -1 Query: 187 CCEDLLV*PLCAV*TLLCCDRGGSAACGCCNRLSC 83 CC+ + P+C+ + LCC + S CC C Sbjct: 170 CCKPICCVPVCSGASSLCCQK-SSCQPACCTTSCC 203
>SNF1_CANAL (P52497) Carbon catabolite derepressing protein kinase (EC| 2.7.11.1) Length = 620 Score = 27.3 bits (59), Expect = 9.5 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +3 Query: 87 LSRLQQPHA-ADPPRSQHNKVHTAHRGHTNKSSQQ 188 +S QP A AD + QHN H H H N++ Q Sbjct: 1 MSEQAQPQASADQQQHQHNHHHHHHHHHHNENQSQ 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,464,966 Number of Sequences: 219361 Number of extensions: 949712 Number of successful extensions: 2304 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2300 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)