| Clone Name | rbastl15d06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CAC1I_HUMAN (Q9P0X4) Voltage-dependent T-type calcium channel al... | 30 | 1.4 | 2 | CAC1I_RAT (Q9Z0Y8) Voltage-dependent T-type calcium channel alph... | 30 | 1.4 | 3 | K0286_MOUSE (Q6ZQE4) Protein KIAA0286 | 29 | 2.3 | 4 | STAB1_HUMAN (Q9NY15) Stabilin-1 precursor (FEEL-1 protein) (MS-1... | 29 | 3.0 | 5 | POLG_HCVEU (O39927) Genome polyprotein [Contains: Core protein p... | 28 | 6.8 |
|---|
>CAC1I_HUMAN (Q9P0X4) Voltage-dependent T-type calcium channel alpha-1I subunit| (Voltage-gated calcium channel alpha subunit Cav3.3) (Ca(v)3.3) Length = 2223 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/65 (26%), Positives = 35/65 (53%) Frame = -2 Query: 277 SSYILSGCLMVVLTLLSQIVMREHKIIHENQLEAVSIFTLQDVV*SSQLSCNYSLVYQME 98 S ++++ CL+V+ T S+ REH+++ E + +S T+ ++ Y ++Q Sbjct: 386 SFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLSSSTVASY---AEPGDCYEEIFQYV 442 Query: 97 CYI*R 83 C+I R Sbjct: 443 CHILR 447
>CAC1I_RAT (Q9Z0Y8) Voltage-dependent T-type calcium channel alpha-1I subunit| (Voltage-gated calcium channel alpha subunit Cav3.3) (CaVT.3) Length = 2201 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/65 (26%), Positives = 35/65 (53%) Frame = -2 Query: 277 SSYILSGCLMVVLTLLSQIVMREHKIIHENQLEAVSIFTLQDVV*SSQLSCNYSLVYQME 98 S ++++ CL+V+ T S+ REH+++ E + +S T+ ++ Y ++Q Sbjct: 384 SFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLSSSTVASY---AEPGDCYEEIFQYV 440 Query: 97 CYI*R 83 C+I R Sbjct: 441 CHILR 445
>K0286_MOUSE (Q6ZQE4) Protein KIAA0286| Length = 437 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/61 (22%), Positives = 28/61 (45%) Frame = -2 Query: 382 WSCPGPGK*CFSGQGGNGACYPDSFDEAELIC*DWSSYILSGCLMVVLTLLSQIVMREHK 203 WS GPG C+ GG GA W +++GC++ ++ ++++E + Sbjct: 10 WSAVGPGPRCWGAGGGGGA--------------TWLLLVVAGCVVCGSADVNVVMLQESQ 55 Query: 202 I 200 + Sbjct: 56 V 56
>STAB1_HUMAN (Q9NY15) Stabilin-1 precursor (FEEL-1 protein) (MS-1 antigen)| Length = 2570 Score = 28.9 bits (63), Expect = 3.0 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +1 Query: 253 SSHLICMKTSLN-KSAQLHRSYLGSKLHCLLDPRSITSLALGK 378 S H C+ T LN + + H Y+G L CL + LG+ Sbjct: 2145 SEHANCLSTGLNTRRCECHAGYVGDGLQCLEESEPPVDRCLGQ 2187
>POLG_HCVEU (O39927) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3017 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = -1 Query: 122 LQFGLSNGVLYLTNECNNST 63 L +G S+G+ +LTN+C+NS+ Sbjct: 191 LTYGNSSGLYHLTNDCSNSS 210 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,145,474 Number of Sequences: 219361 Number of extensions: 1071044 Number of successful extensions: 2250 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2249 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)