| Clone Name | rbastl15d04 |
|---|---|
| Clone Library Name | barley_pub |
>HRCA_HELPY (O24933) Heat-inducible transcription repressor hrcA homolog| Length = 266 Score = 28.9 bits (63), Expect = 3.4 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 3/93 (3%) Frame = -2 Query: 313 ILRNDGPLYHRKAGSKLFQT--TFCCCCKNAQRFEFLKS*HEFLKQGRKWNCKSLLISKP 140 IL +G LY + T F + + RFE LK + LK + L+ KP Sbjct: 56 ILSKEGMLYQAHSSGARLPTFKAFENYWQKSLRFETLKVNEKRLKSASENFGLFTLLKKP 115 Query: 139 GRNHLDRVILQDVNVLILRF-SLSCYPFHDMKL 44 L+RVI + LIL F + SC + +K+ Sbjct: 116 SLERLERVIECEKRFLILDFLAFSCALGYSVKM 148
>RNPA_RICPR (Q9ZCU8) Ribonuclease P protein component (EC 3.1.26.5) (RNaseP| protein) (RNase P protein) (Protein C5) Length = 121 Score = 28.5 bits (62), Expect = 4.5 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%) Frame = -2 Query: 280 KAGSKLFQTTFCCCCKNAQRFEFLKS*HEF---LKQGRKWNCKSLLISKPGRN--HLDRV 116 K G K ++ F FL+S + +K RK N K+++ +K R HL R+ Sbjct: 19 KLGEKFYERYFILVIAKKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLMRI 78 Query: 115 ILQDVNVLILRFSLSCYP 62 I+ D N ++F++ P Sbjct: 79 IVNDSNFKAIKFAIIIIP 96
>G109B_HUMAN (P49019) Nicotinic acid receptor 2 (G-protein coupled receptor| 109B) (G-protein coupled receptor HM74) (G-protein coupled receptor HM74B) Length = 387 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/58 (24%), Positives = 29/58 (50%) Frame = +3 Query: 132 FLPGFEISRDLQFHLRPCLRNSCQLFRNSNLWAFLQQQQKVVWNSLEPAFLWYSGPSF 305 FLP + + + L +C+++R+ +L F+ + + L+P ++S PSF Sbjct: 244 FLPSVVVRIRIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPSF 301
>G109A_HUMAN (Q8TDS4) Nicotinic acid receptor 1 (G-protein coupled receptor| 109A) (G-protein coupled receptor HM74A) Length = 363 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/58 (24%), Positives = 29/58 (50%) Frame = +3 Query: 132 FLPGFEISRDLQFHLRPCLRNSCQLFRNSNLWAFLQQQQKVVWNSLEPAFLWYSGPSF 305 FLP + + + L +C+++R+ +L F+ + + L+P ++S PSF Sbjct: 244 FLPSVVVRIRIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPSF 301
>HRCA_HELPJ (Q9ZMW2) Heat-inducible transcription repressor hrcA homolog| Length = 266 Score = 27.3 bits (59), Expect = 9.9 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -2 Query: 223 RFEFLKS*HEFLKQGRKWNCKSLLISKPGRNHLDRVILQDVNVLILRF-SLSCYPFHDMK 47 RFE LK + LK + L+ KP L+RVI + LIL F + SC + +K Sbjct: 88 RFEVLKVNEKRLKSASENFGLFTLLKKPSLERLERVIECEKRFLILDFLAFSCAVGYSVK 147 Query: 46 L 44 + Sbjct: 148 M 148 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,544,093 Number of Sequences: 219361 Number of extensions: 706187 Number of successful extensions: 1742 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1741 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)