| Clone Name | rbastl15a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATPG_BUCAI (P57123) ATP synthase gamma chain (EC 3.6.3.14) (ATP ... | 28 | 5.5 | 2 | V2A_BBMV (P27462) RNA-directed RNA polymerase 2A (EC 2.7.7.48) (... | 28 | 7.2 | 3 | ADK_CRIGR (P55262) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosin... | 27 | 9.4 | 4 | ADK_HUMAN (P55263) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosin... | 27 | 9.4 |
|---|
>ATPG_BUCAI (P57123) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +3 Query: 195 AANSYTNLVFRPSNKTVVQTIFSEYIEQYLSQ 290 A+N+ + ++ P +K ++ T+F+ YIE + Q Sbjct: 199 ASNNNWDYLYEPESKLILDTLFNRYIESQVYQ 230
>V2A_BBMV (P27462) RNA-directed RNA polymerase 2A (EC 2.7.7.48) (protein 2A)| Length = 810 Score = 27.7 bits (60), Expect = 7.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 60 HCCTETHLYFDNSYYRDF 7 H +TH YFD+SYY F Sbjct: 251 HNALKTHAYFDDSYYEGF 268
>ADK_CRIGR (P55262) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosine| 5'-phosphotransferase) Length = 361 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 237 CLTAERRGLCRNSRQARCYMGEKNL 163 C+T + R L N A CY EK+L Sbjct: 142 CITGDNRSLVANLAAANCYKKEKHL 166
>ADK_HUMAN (P55263) Adenosine kinase (EC 2.7.1.20) (AK) (Adenosine| 5'-phosphotransferase) Length = 362 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 237 CLTAERRGLCRNSRQARCYMGEKNL 163 C+T + R L N A CY EK+L Sbjct: 143 CITGDNRSLIANLAAANCYKKEKHL 167 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,327,385 Number of Sequences: 219361 Number of extensions: 824435 Number of successful extensions: 1436 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1436 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)