| Clone Name | rbastl14g07 |
|---|---|
| Clone Library Name | barley_pub |
>RL1D1_PONPY (Q5RCE6) Ribosomal L1 domain-containing protein 1| Length = 490 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = -3 Query: 252 NVQKIKERDEKRKIARKSALRLKMDLQLVSSGDAMI 145 N +K KER +KR+ ARK+A L D SGD + Sbjct: 295 NFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTV 330
>RL1D1_HUMAN (O76021) Ribosomal L1 domain-containing protein 1 (Cellular| senescence-inhibited gene protein) (PBK1 protein) (CATX-11) Length = 490 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = -3 Query: 252 NVQKIKERDEKRKIARKSALRLKMDLQLVSSGDAMI 145 N +K KER +KR+ ARK+A L D SGD + Sbjct: 295 NFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTV 330
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 29.3 bits (64), Expect = 2.6 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Frame = +1 Query: 16 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVGRDHCISRGH 168 + R+ PE ++L TPTQ F +HR+ +K+A + KG + GH Sbjct: 565 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGH 619
>HNK2_XENLA (P42587) Homeobox protein XENK-2| Length = 196 Score = 28.5 bits (62), Expect = 4.4 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +1 Query: 16 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGV 138 + R+ PE ++L TPTQ F +HR+ K+A S KG+ Sbjct: 89 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARSEKGM 133
>TRUA_SYNEL (Q8CWM6) tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA-uridine| isomerase I) (tRNA pseudouridylate synthase I) Length = 284 Score = 28.1 bits (61), Expect = 5.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 82 HLFLHHRFLSKKASSWKGVGRDHCISRGH*LKIHLQSQG 198 HL HR S +A SW V C RG ++I +Q+ G Sbjct: 163 HLSAFHRSGSNRAHSWVEVQAVSCQRRGALVEIEVQASG 201
>NX22A_BRARE (Q90481) Homeobox protein Nkx-2.2a (Homeobox protein NK-2 homolog| B) Length = 269 Score = 28.1 bits (61), Expect = 5.7 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +1 Query: 16 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGVGRDH 150 + R+ PE ++L TPTQ F +HR+ K+A + KG+ H Sbjct: 145 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTH 193
>HISX_BLOFL (Q7VQX0) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 437 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 157 RCNDLSQLPSMMRPFLTKNGGVRIDVKFVL 68 RC+ QL + RP N + +DVK++L Sbjct: 14 RCSISEQLTLLTRPINKHNNSIHLDVKYIL 43
>FDHE_AQUAE (O67150) Protein fdhE homolog| Length = 283 Score = 27.7 bits (60), Expect = 7.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 131 FHDEAFFDKKRWCKNRCEVC 72 F D+ F+ +RW KN C VC Sbjct: 151 FADKVKFEHERWFKNYCPVC 170
>HSDR_STAAN (Q7A801) Type-1 restriction enzyme R protein (EC 3.1.21.3) (Type I| restriction enzyme R protein) Length = 929 Score = 27.3 bits (59), Expect = 9.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 119 AFFDKKRWCKNRCEV 75 +F DKK WCKN+ +V Sbjct: 95 SFLDKKSWCKNKFQV 109
>HSDR_STAAM (Q99X26) Type-1 restriction enzyme R protein (EC 3.1.21.3) (Type I| restriction enzyme R protein) Length = 929 Score = 27.3 bits (59), Expect = 9.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 119 AFFDKKRWCKNRCEV 75 +F DKK WCKN+ +V Sbjct: 95 SFLDKKSWCKNKFQV 109
>ERG6_PNECA (Q96WX4) Sterol 24-C-methyltransferase (EC 2.1.1.41)| (Delta(24)-sterol C-methyltransferase) Length = 377 Score = 27.3 bits (59), Expect = 9.8 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -3 Query: 321 CHVGGPLCQ---FHTTGTVG**RCFYNVQKIKERDEKRKIARK 202 C VGGP CQ F VG Y +Q+ K EK+ ++ K Sbjct: 135 CGVGGPACQISVFTGANIVGLNNNDYQIQRAKYYSEKKGLSDK 177
>NKX22_MOUSE (P42586) Homeobox protein Nkx-2.2 (Homeobox protein NK-2 homolog B)| Length = 273 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +1 Query: 16 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGV 138 + R+ PE ++L TPTQ F +HR+ K+A + KG+ Sbjct: 148 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGM 192
>NKX22_MESAU (P43697) Homeobox protein Nkx-2.2 (Homeobox protein NK-2 homolog B)| Length = 273 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +1 Query: 16 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGV 138 + R+ PE ++L TPTQ F +HR+ K+A + KG+ Sbjct: 148 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGM 192
>NKX22_HUMAN (O95096) Homeobox protein Nkx-2.2 (Homeobox protein NK-2 homolog B)| Length = 273 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = +1 Query: 16 KSMRH*KGPEIQYLNP----TPTQTSHLFLHHRFLSKKASSWKGV 138 + R+ PE ++L TPTQ F +HR+ K+A + KG+ Sbjct: 148 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGM 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,425,290 Number of Sequences: 219361 Number of extensions: 715941 Number of successful extensions: 1937 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1937 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)