| Clone Name | rbastl14d04 |
|---|---|
| Clone Library Name | barley_pub |
>SAMD6_HUMAN (Q68DC2) Sterile alpha motif domain-containing protein 6 (Ankyrin| repeat domain-containing protein 14) Length = 871 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = -3 Query: 315 LSSKLYLAKLPSMA*DTPSRESSSS--PAMTCRNHTRENTLATSSKHRK 175 + KL +K P T S+ +S + P+ + + HT E+++++SS HR+ Sbjct: 712 VGKKLETSKRPPSGTSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQ 760
>TRPB_RHOS4 (Q9X4E5) Tryptophan synthase beta chain (EC 4.2.1.20)| Length = 409 Score = 28.1 bits (61), Expect = 5.6 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -2 Query: 349 DAKNKEDF-LIYAFK*TVPGKTPLHGLRHTIKRIILLPRDDV 227 DA+ E F L A + +P P H L H IK LPRD + Sbjct: 342 DAEALEAFQLCCALEGIIPALEPSHALAHVIKIAPTLPRDHI 383
>VE1_HPV33 (P06421) Replication protein E1 (EC 3.6.1.-) (ATP-dependent| helicase E1) Length = 644 Score = 27.7 bits (60), Expect = 7.3 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +2 Query: 23 ITGQSVSPHTHKKNKFLFRANSSYLHTTYYSINI*RCLLGNYNLHSLMTMSFRC 184 ITG +SP + K L + +S Y H +CL + + L+ + FRC Sbjct: 231 ITGYGISPSVAESLKVLIKQHSLYTHL--------QCLTCDRGIIILLLIRFRC 276
>STE23_YEAST (Q06010) A-factor-processing enzyme (EC 3.4.99.-)| Length = 1027 Score = 27.7 bits (60), Expect = 7.3 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +3 Query: 27 LVSQSAPTHTKKINSFSGLTLVTYIQHITA*IYKGVYWETIIY 155 ++++ + + +K+ F LT I I IY+GVY+ET+I+ Sbjct: 699 IINERSWSTAEKLQVFEKLTFEQLINFIPT-IYEGVYFETLIH 740
>RPOP_NEUCR (P33540) Probable DNA-directed RNA polymerase (EC 2.7.7.6)| Length = 896 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +2 Query: 38 VSPHTHKKNKFLFRANSSYLHTTYYSINI*RCLLGNYNLHSLMTMSFRCLE 190 V PH ++ + A+ SY HT IN+ RCL+ LMT+++ E Sbjct: 586 VIPHIKQE---ILEASKSYEHTNLERINVERCLV----KRGLMTITYGATE 629
>SAMD6_MOUSE (Q6GQX6) Sterile alpha motif domain-containing protein 6| Length = 883 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = -3 Query: 312 SSKLYLAKLPSMA*DTPSRESSSS--PAMTCRNHTRENTLATSSKHRK 175 S KL +K P S+ +S + P+ + + HT E+++++SS HR+ Sbjct: 711 SKKLDPSKRPPSGTSATSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQ 758
>PI5K7_ARATH (Q9SUI2) Phosphatidylinositol-4-phosphate 5-kinase 7 (EC 2.7.1.68)| (AtPIP5K7) (1-phosphatidylinositol-4-phosphate kinase 7) (PtdIns(4)P-5-kinase 7) (Diphosphoinositide kinase 7) (AtP5K2) Length = 754 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -2 Query: 277 GLRHTIKRIILLPRDDVSQSHTGKHASNK 191 G+R+T+ +I +PR +V S GK+A K Sbjct: 342 GIRYTVGKITPVPRREVRASDFGKNARTK 370 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,384,953 Number of Sequences: 219361 Number of extensions: 1071557 Number of successful extensions: 2318 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2314 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)