| Clone Name | rbastl13g04 |
|---|---|
| Clone Library Name | barley_pub |
>RBP2_HUMAN (P49792) Ran-binding protein 2 (RanBP2) (Nuclear pore complex protein| Nup358) (Nucleoporin Nup358) (358 kDa nucleoporin) (P270) Length = 3224 Score = 35.8 bits (81), Expect = 0.030 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 17/89 (19%) Frame = +2 Query: 47 LVNNATNITPSDDFCVKLNGIFPILLVYAA-----CPPLPS--CCLFSLAIHGPASLL-- 199 L+ A N+TP+ +N + P +YA PP+ S C+FS ++GP +L Sbjct: 888 LLRPAANVTPTKGPVYGMNRLPPQQHIYAYPQQMHTPPVQSSSACMFSQEMYGPPALRFE 947 Query: 200 --------PVGEDGLQILVQRLGLGPPLP 262 P G+D VQ+ PPLP Sbjct: 948 SPATGILSPRGDDYFNYNVQQTSTNPPLP 976
>RBP2_MOUSE (Q9ERU9) Ran-binding protein 2 (RanBP2)| Length = 3053 Score = 35.4 bits (80), Expect = 0.039 Identities = 27/88 (30%), Positives = 39/88 (44%), Gaps = 16/88 (18%) Frame = +2 Query: 47 LVNNATNITPSDDFCVKLNGIFPILLVYAAC-----PPLPS--CCLFSLAIHGP------ 187 L+ A N+TP+ +N + P +YA PP+ S C+FS ++GP Sbjct: 888 LLRPAANVTPTKGPVYGMNRLPPQQHIYAYSQQMHTPPVQSSSACMFSQEMYGPPLRFES 947 Query: 188 ---ASLLPVGEDGLQILVQRLGLGPPLP 262 L P G+D VQ+ PPLP Sbjct: 948 PATGILSPRGDDYFNYNVQQTSTNPPLP 975
>ATP8_LOXNO (Q9MDJ1) ATP synthase protein 8 (EC 3.6.3.14) (ATPase subunit 8)| (A6L) Length = 55 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +1 Query: 148 PLMLLILTCNPWTRKPATCWRRWPPNPCTAPWTWAST 258 P +L +T NP + KP P P T PWTW T Sbjct: 26 PKLLTFVTMNPPSNKP-------PIAPSTTPWTWPWT 55
>Y6509_BACAN (Q9RN22) Hypothetical protein pXO2-10/BXB0009/GBAA_pXO2_0009| Length = 224 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +1 Query: 97 IKRHISYITSICSVSPPPLMLLILTCNPWTRKPATCWRR 213 +KR ++ +TS+C V P +L LT + T + W+R Sbjct: 87 LKRFMNQLTSLCRVYHEPFKILSLTYSTETTEQQVYWKR 125
>NOL6_MOUSE (Q8R5K4) Nucleolar protein 6 (Nucleolar RNA-associated protein)| (Nrap) Length = 1141 Score = 28.1 bits (61), Expect = 6.2 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 131 AACPPLPSCCLFSLAIHGPASLLPV-GEDGLQILVQRL 241 A PP+ S C LA GP+SL+PV G D Q+ + +L Sbjct: 1020 AVDPPVASFCRGLLAEPGPSSLMPVLGYDPPQLYLAQL 1057
>ATS14_HUMAN (Q8WXS8) ADAMTS-14 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 14) (ADAM-TS 14) (ADAM-TS14) Length = 1223 Score = 27.7 bits (60), Expect = 8.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 178 PWTRKPATCWRRWPPNPCTAPWTWASTP 261 P T P W P P PW W TP Sbjct: 1168 PETPIPGASWSISPTTPGGLPWGWTQTP 1195
>SAS_DROME (Q04164) Putative epidermal cell surface receptor precursor| (Stranded at second protein) Length = 1693 Score = 27.7 bits (60), Expect = 8.1 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +2 Query: 65 NITPSDDFCVKLNGIFPILLVYAACPPLPSCCLFSLAIH-GPASLLPVGED 214 N+T D C NG AACPP+P+ L H A LLP+ +D Sbjct: 846 NLTGCDQHCYCENGRVECR---AACPPVPALPPADLPCHPALARLLPIPDD 893
>YI61_XANCV (P25438) Insertion element IS476 hypothetical 39.2 kDa protein| Length = 346 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = -2 Query: 258 SGGPSPRRCTRIWRPSSPTGSRLAGPWIASENKQHEGRGGH 136 SGGPS T WRP+ R GP + E G GH Sbjct: 10 SGGPS----TGGWRPTRQAAERTGGPEHSIEEVAGRGAPGH 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,522,246 Number of Sequences: 219361 Number of extensions: 838582 Number of successful extensions: 2577 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2576 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)