| Clone Name | rbastl13g03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SUMF1_MOUSE (Q8R0F3) Sulfatase-modifying factor 1 precursor (C-a... | 29 | 3.3 | 2 | BAZ2A_MOUSE (Q91YE5) Bromodomain adjacent to zinc finger domain ... | 29 | 3.3 | 3 | VIT1_PERAM (Q9U8M0) Vitellogenin 1 precursor (Vg-1) | 28 | 5.7 | 4 | PAX6_XENLA (P55864) Paired box protein Pax-6 | 28 | 7.4 |
|---|
>SUMF1_MOUSE (Q8R0F3) Sulfatase-modifying factor 1 precursor| (C-alpha-formyglycine-generating enzyme 1) Length = 372 Score = 28.9 bits (63), Expect = 3.3 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = -3 Query: 280 EHANGSAGL*TRGICGCWTSCEANSDGGKIAVNHLSRAASQPRL 149 E G+A L G CGC T A + G A SR A+ P L Sbjct: 36 EAREGAASL--AGSCGCGTPQRAGAHGSSAAAQRYSREANAPGL 77
>BAZ2A_MOUSE (Q91YE5) Bromodomain adjacent to zinc finger domain 2A (Transcription| termination factor I-interacting protein 5) (TTF-I-interacting protein 5) (Tip5) Length = 1850 Score = 28.9 bits (63), Expect = 3.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 198 PPSEFASQEVQHPHIPLV*SPALPLACSGTW 290 PPS+F Q QH L P P CSG W Sbjct: 1357 PPSKFFKQVEQHYLTQLTAQPIPPEMCSGWW 1387
>VIT1_PERAM (Q9U8M0) Vitellogenin 1 precursor (Vg-1)| Length = 1896 Score = 28.1 bits (61), Expect = 5.7 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +2 Query: 209 ICFAGSPAPAYSPGLEPSAAVGMFRDLDCFTKGP 310 ICF+ P P +P +P+ + C TKGP Sbjct: 1826 ICFSMRPLPECAPRFKPADTLKKKIKFHCLTKGP 1859
>PAX6_XENLA (P55864) Paired box protein Pax-6| Length = 422 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -1 Query: 288 RSRNMPTAALGSRPGEYAGAGLPAKQIQ 205 R N TA GSRPG Y G +P + Q Sbjct: 147 RMLNGQTATWGSRPGWYPGTSVPGQPAQ 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,411,006 Number of Sequences: 219361 Number of extensions: 1028902 Number of successful extensions: 2704 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2704 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)