| Clone Name | rbastl13f05 |
|---|---|
| Clone Library Name | barley_pub |
>MACF1_MOUSE (Q9QXZ0) Microtubule-actin crosslinking factor 1 (Actin| cross-linking family 7) Length = 5327 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 312 SSVYIYGESGDSSTKKVLVRWVCK 241 S +YI GESGD S K+ L+ W K Sbjct: 183 SDIYISGESGDMSAKEKLLLWTQK 206
>MACF1_HUMAN (Q9UPN3) Microtubule-actin crosslinking factor 1, isoforms 1/2/3/5| (Actin cross-linking family protein 7) (Macrophin-1) (Trabeculin-alpha) (620 kDa actin-binding protein) (ABP620) Length = 5430 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 312 SSVYIYGESGDSSTKKVLVRWVCK 241 S +YI GESGD S K+ L+ W K Sbjct: 183 SDIYISGESGDMSAKEKLLLWTQK 206
>ACOD_CYPCA (Q92038) Acyl-CoA desaturase (EC 1.14.19.1) (Stearoyl-CoA| desaturase) (Fatty acid desaturase) (Delta(9)-desaturase) Length = 327 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 270 WLRSHQIHHKYRQTIA 317 W R H++HHKY +T A Sbjct: 120 WSRDHRVHHKYSETDA 135
>TMOE_PSEME (Q00460) Toluene-4-monooxygenase system protein E (EC 1.14.13.-)| Length = 326 Score = 28.1 bits (61), Expect = 5.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 12 TICPLLINETIVQKSQHSRWKQQLCQSGLSS 104 T+ PLLI+ + +HSRW + L + L + Sbjct: 244 TLLPLLIDSQLKDAERHSRWSKALVKHALEN 274
>ATS20_HUMAN (P59510) ADAMTS-20 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 20) (ADAM-TS 20) (ADAM-TS20) Length = 1911 Score = 27.7 bits (60), Expect = 7.5 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 9/54 (16%) Frame = -2 Query: 256 EMGVQGPRMVMMVDGSGN*SAQTSYGQNSCSRS---------CVDELYDEDLHY 122 E+ VQG R V+ GS N + NS +R CV LY+ D+HY Sbjct: 786 EINVQGTRTVIEYSGSNNAVERI----NSTNRQEKELILQVLCVGNLYNPDVHY 835
>YO21_CAEEL (P34671) Hypothetical protein ZK688.1| Length = 192 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +3 Query: 189 VCALQFPLPSTIITILGPCTPISPKPFWLRSHQIHHKYRQTI 314 +C L F T+ C P SP P+ +H +H + QT+ Sbjct: 6 LCILYF-----FTTVTQQCAPHSPSPWTKTTHVNNHHHHQTV 42
>ACOD_BOVIN (Q9TT94) Acyl-CoA desaturase (EC 1.14.19.1) (Stearoyl-CoA| desaturase) (Fatty acid desaturase) (Delta(9)-desaturase) Length = 359 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +3 Query: 210 LPSTIITILGPCTPISPKPF-WLRSHQIHHKYRQTIA 317 LP + I+G F W R H+ HHK+ +T A Sbjct: 132 LPLRVFLIIGNTMAFQNDVFEWSRDHRAHHKFSETDA 168
>ACO11_TRINI (O44390) Acyl-CoA delta-11 desaturase (EC 1.14.19.-)| (Delta(11)-desaturase) Length = 349 Score = 27.3 bits (59), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 270 WLRSHQIHHKYRQTIA 317 W R H++HHKY T A Sbjct: 119 WAREHRLHHKYSDTDA 134 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,936,345 Number of Sequences: 219361 Number of extensions: 771160 Number of successful extensions: 1533 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1533 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)