| Clone Name | rbastl13d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RT16_MYXXA (P23072) RNA-directed DNA polymerase from retron Mx16... | 30 | 1.6 | 2 | SPAT7_HUMAN (Q9P0W8) Spermatogenesis-associated protein 7 (Sperm... | 30 | 2.1 | 3 | G3ST2_MOUSE (Q6XQH0) Galactose 3-O-sulfotransferase 2 (EC 2.8.2.... | 28 | 4.6 |
|---|
>RT16_MYXXA (P23072) RNA-directed DNA polymerase from retron Mx162-RT (EC| 2.7.7.49) (Reverse transcriptase) (Mx162-RT) Length = 485 Score = 30.0 bits (66), Expect = 1.6 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +2 Query: 137 KKPGYKETSDSSQVSTPPPSLQAGSRPLQSHLLELLPIHQTKCKAHGW 280 K+ G K T +++P P L+A R + S+++E LP+H AHG+ Sbjct: 188 KRDGSKRT-----ITSPKPELKAAQRWVLSNVVERLPVHGA---AHGF 227
>SPAT7_HUMAN (Q9P0W8) Spermatogenesis-associated protein 7| (Spermatogenesis-associated protein HSD3) (HSD-3.1) Length = 599 Score = 29.6 bits (65), Expect = 2.1 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = +3 Query: 108 LEFSFKLHVPKNLGTKKHLIPPKYQRLLHPCRLEAGRFNHICLSFSPSIKQN 263 LE F+ H+ +N KHL K + LLH +++ G C S S+KQN Sbjct: 389 LERLFERHIKQN----KHLEEEKMRHLLHVLKVDLG-----CTSEENSVKQN 431
>G3ST2_MOUSE (Q6XQH0) Galactose 3-O-sulfotransferase 2 (EC 2.8.2.-) (Gal3ST-2)| (Galbeta1-3GalNAc 3'-sulfotransferase 2) (Beta-galactose-3-O-sulfotransferase 2) Length = 394 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 Query: 117 SFKLHVPKNLGTKKHLIPPKYQRLLHPCRLEAGRFNHICLSF 242 SFKL+V ++ T HL P +R+ H C L+ + H +F Sbjct: 247 SFKLNV-RSQSTVSHLTPESQERVQHWCALDWQLYQHFNRTF 287 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,099,620 Number of Sequences: 219361 Number of extensions: 868177 Number of successful extensions: 2162 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2162 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)