| Clone Name | rbastl13d03 |
|---|---|
| Clone Library Name | barley_pub |
>CAD13_CHICK (P33150) Cadherin-13 precursor (Truncated-cadherin) (T-cadherin)| (T-cad) Length = 712 Score = 30.4 bits (67), Expect = 1.2 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +3 Query: 102 NSHIQFILLKDSCLRNFHCPACIFSVASPPITSSMRSLKMDLSMSK--TMPCSSPSGL 269 N+H Q +LL++ N++ P + PP+T++ LK+ + K M CS+ L Sbjct: 639 NTHAQVVLLQNLKKANYNIPISVTDSGKPPLTNN-TELKLQVCSCKKSRMDCSASDAL 695
>Y163_SYNY3 (Q55563) Hypothetical WD-repeat protein sll0163| Length = 1693 Score = 29.6 bits (65), Expect = 2.0 Identities = 20/59 (33%), Positives = 27/59 (45%) Frame = +2 Query: 59 LHLLVAKIPNGNDYQQSYSVYTTERQLPTQFPLSSLHLLCSLATYNLVNEVPENGPLNV 235 L L+A + G D Q+ + T Q P+ P SLH + LA N N GP+ V Sbjct: 959 LEALLAAVKTGQDLQKLVTPETPLVQYPSLAPWLSLHSI--LARINECNRCHHEGPVTV 1015
>EXS_ARATH (Q9LYN8) Leucine-rich repeat receptor protein kinase EXS precursor| (EC 2.7.11.1) (Extra sporogenous cells protein) (EXCESS MICROSPOROCYTES1 protein) Length = 1192 Score = 29.6 bits (65), Expect = 2.0 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +3 Query: 135 SCLRNFHCPACIFSVASPPITSSMRSL-KMDLSMSKTMPCSSP 260 S L+NF P+C F+ P S ++ L K+DLS + + CS P Sbjct: 210 SLLKNFAAPSCFFNGPLPKEISKLKHLAKLDLSYN-PLKCSIP 251
>MEGF6_RAT (O88281) Multiple epidermal growth factor-like domains 6 precursor| (EGF-like domain-containing protein 3) (Multiple EGF-like domain protein 3) Length = 1574 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = -2 Query: 168 CKLDNGNCVGSCLSVV*TEYDC**SFPLGILATSKCNPLYFLSED 34 C L NG C C+ + T++ C +C P Y L ED Sbjct: 209 CTLGNGGCQHQCVQLTVTQHRC------------QCRPQYQLQED 241
>LAR_CAEEL (Q9BMN8) Tyrosine-protein phosphatase Lar-like precursor (EC| 3.1.3.48) (Protein-tyrosine phosphate 3) Length = 2200 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 180 ASPPITSSMRSLKMDLSMSKTMPCSSPSGLPQSFISY 290 A+ P++ RSL D + K PC P+GL + Y Sbjct: 437 ATAPVSPQARSLNRDSILVKWGPCEQPNGLITGYKVY 473
>ENGA_RHILO (Q986D9) GTP-binding protein engA| Length = 479 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 6/45 (13%) Frame = +3 Query: 186 PPITSSMRSLKMDLSMSKTMP------CSSPSGLPQSFISYNASS 302 PP + R ++ +KT P CS P +PQS++ Y ++S Sbjct: 404 PPAVAGRRLKVKYVTQAKTRPPGFVVQCSRPDAMPQSYVRYLSNS 448
>ATL1P_ARATH (Q9XF63) RING-H2 finger protein ATL1P (RING-H2 finger protein ATL3)| Length = 324 Score = 28.1 bits (61), Expect = 5.8 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 180 ASPPITSSMRSLKMDLSMSKTMPCSSPSGLPQSFISYNASSDNGMFS 320 A P+T+ +RSL+ LS K + CS+ S + N+SS N + S Sbjct: 282 AKSPMTTRLRSLRRFLSRDKRVGCSNSS-------TSNSSSSNAVAS 321
>Y676_MYCPN (P75116) Hypothetical protein MPN676 (K05_orf106)| Length = 106 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/57 (24%), Positives = 29/57 (50%) Frame = +2 Query: 20 FYIIQSSERKYKGLHLLVAKIPNGNDYQQSYSVYTTERQLPTQFPLSSLHLLCSLAT 190 +Y+ +++ ++ +K+P+GN Q ++ T+ L + LS HLL + T Sbjct: 46 YYVFGFFTFRWQRSLIITSKVPSGNGIQFDFNSRTSHWLLNFLYSLSEYHLLFKVKT 102
>GLB_NASMU (P31331) Globin (Myoglobin)| Length = 147 Score = 28.1 bits (61), Expect = 5.8 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = -1 Query: 226 RSIFRDLIDEVIGGEATEKMQA 161 RSIF + +D+ GG+ATE M++ Sbjct: 112 RSIFGEFLDKATGGKATESMKS 133
>ENGA_BRUSU (Q8G2E8) GTP-binding protein engA| Length = 483 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 6/41 (14%) Frame = +3 Query: 186 PPITSSMRSLKMDLSMSKTMP------CSSPSGLPQSFISY 290 PP S R ++ KT P CS P +PQS++ Y Sbjct: 408 PPAVSGRRLKVKYMTQVKTRPPGFVVSCSRPDAMPQSYVRY 448
>ENGA_BRUME (Q8YFH2) GTP-binding protein engA| Length = 483 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 6/41 (14%) Frame = +3 Query: 186 PPITSSMRSLKMDLSMSKTMP------CSSPSGLPQSFISY 290 PP S R ++ KT P CS P +PQS++ Y Sbjct: 408 PPAVSGRRLKVKYMTQVKTRPPGFVVSCSRPDAMPQSYVRY 448
>SYFB_NOVAD (Q2GAI7) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 796 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -1 Query: 238 LDIERSIFRDLIDEVIGGEATEKMQAGQWKLRRQ 137 LD + LI E+ GGEA+E ++AG+ L R+ Sbjct: 368 LDTGLDLLTSLILEICGGEASEVVRAGEPPLARK 401
>DHB1_RAT (P51657) Estradiol 17-beta-dehydrogenase 1 (EC 1.1.1.62)| (17-beta-HSD 1) (17-beta-hydroxysteroid dehydrogenase 1) Length = 344 Score = 27.7 bits (60), Expect = 7.5 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 Query: 56 GLHLLVAKIPNGNDYQQSYSVYTTERQLPTQFPL 157 GLHL V +D QS+ VY T R L +Q PL Sbjct: 16 GLHLAVRL---ASDRSQSFKVYATLRDLKSQGPL 46
>ABP1_YEAST (P15891) Actin-binding protein| Length = 591 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +3 Query: 180 ASPPITSSMRSLKMDLSMSKTMPCSSPSGLPQSFISYNASSDN 308 ++PP+ S K +SK P +PS P + IS + +N Sbjct: 155 STPPVKKSFTPSKSPAPVSKKEPVKTPSPAPAAKISSRVNDNN 197 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,600,703 Number of Sequences: 219361 Number of extensions: 856535 Number of successful extensions: 2582 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2582 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)